Recombinant AAV-2 VP3 Protein
Cat.No. : | VP3-1781A |
Product Overview : | Recombinant protein from the full-length sequence of AAV-2 major coat protein VP3 , was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | AAV2 |
Source : | E.coli |
Protein Length : | 1-533aa |
Description : | major coat protein VP3 [Adeno-associated virus - 2]. |
Form : | 50mM Tris, 300mM NaCl, 10% glycerol, pH 8.0. |
Molecular Mass : | The protein has a calculated MW of 60.3kDa. |
AA Sequence : | GSHMATGSGAPMADNNEGADGVGNSSGNWHCDSTWMGDRVITTSTRTWALPTYNNHLYKQISSQSGASNDNHYFGYSTPWGYFDFNRFHCHFSPRDWQRLINNNWGFRPKRLNFKLFNIQVKEVTQNDGTTTIANNLTSTVQVFTDSEYQLPYVLGSAHQGCLPPFPADVFMVPQYGYLTLNNGSQAVGRSSFYCLEYFPSQMLRTGNNFTFSYTFEDVPFHSSYAHSQSLDRLMNPLIDQYLYYLSRTNTPSGTTTQSRLQFSQAGASDIRDQSRNWLPGPCYRQQRVSKTSADNNNSEYSWTGATKYHLNGRDSLVNPGPAMASHKDDEEKFFPQSGVLIFGKQGSEKTNVDIEKVMITDEEEIRTTNPVATEQYGSVSTNLQRGNRQAATADVNTQGVLPGMVWQDRDVYLQGPIWAKIPHTDGHFHPSPLMGGFGLKHPPPQILIKNTPVPANPSTTFSAAKFASFITQYSTGQVSVEIEWELQKENSKRWNPEIQYTSNYNKSVNVDFTVDTNGVYSEPRPIGTRYLTRNL |
Purity : | >90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.13 mg/ml |
Gene Name | AAV2gp07 major coat protein VP3 [ Adeno-associated virus - 2 ] |
Official Symbol | AAV2gp07 |
Synonyms | VP3 |
Gene ID | 4192016 |
Protein Refseq | YP_680428.1 |
◆ Recombinant Proteins | ||
VP3-318A | Recombinant AAV-8 VP3 Protein, His-tagged | +Inquiry |
VP3-05A | Recombinant AAV2 VP3 Protein, N-His-tagged | +Inquiry |
VP3-1781A | Recombinant AAV-2 VP3 Protein | +Inquiry |
VP3-20A | Recombinant AAV9 VP3 Protein, N-His-tagged | +Inquiry |
RFL23359SF | Recombinant Full Length Structural Protein Vp3(Vp3) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VP3 Products
Required fields are marked with *
My Review for All VP3 Products
Required fields are marked with *
0
Inquiry Basket