Recombinant A. giganteus AFP Protein, His-B2M-tagged

• Cat.No.: AFP-1109A
• Product Overview: Recombinant Aspergillus giganteus AFP Protein (44-94aa) was expressed in E. coli with N-terminal His-B2M-tag.

Specification

• Species: A.giganteus
• Source: E.coli
• Tag: B2M&His
• Protein Length: 44-94 a.a.
• Description: This protein inhibits the growth of a variety of fungal species.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 19.8 kDa
• AA Sequence: ATYNGKCYKKDNICKYKAQSGKTAICKCYVKKCPRDGAKCEFDSYKGKCYC
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: Antifungal protein
• Official Symbol: Antifungal protein
• Synonyms: Antifungal protein; AFP; antifungal protein Afp
• UniProt ID: P17737