Recombinant A. giganteus AFP Protein, His-B2M-tagged

Cat.No. : AFP-1109A
Product Overview : Recombinant Aspergillus giganteus AFP Protein (44-94aa) was expressed in E. coli with N-terminal His-B2M-tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : A.giganteus
Source : E.coli
Tag : B2M&His
Protein Length : 44-94 a.a.
Description : This protein inhibits the growth of a variety of fungal species.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 19.8 kDa
AA Sequence : ATYNGKCYKKDNICKYKAQSGKTAICKCYVKKCPRDGAKCEFDSYKGKCYC
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name Antifungal protein
Official Symbol Antifungal protein
Synonyms Antifungal protein; AFP; antifungal protein Afp;
UniProt ID P17737

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Antifungal protein Products

Required fields are marked with *

My Review for All Antifungal protein Products

Required fields are marked with *

0

Inquiry Basket

cartIcon