Native Human ALB therapeutic protein (Albumin iodinated I-131 serum)
Cat.No. : | ALB-P042H |
Product Overview : | A diagnostic radiopharmaceutical containing iodinated I 131 albumin for intravenous imaging. Following intravenous injection, radioiodinated albumin human is uniformly distributed throughout the intravascular pool within 10 minutes; extravascular distribution takes place more slowly (2 days). Indicated for use in determinations of total blood and plasma volumes, cardiac output, cardiac and pulmonary blood volumes and circulation times |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Non |
Description : | Regulates the colloidal osmotic pressure of blood. It is used to increase the circulating plasma volume, thereby reducing hemoconcentrtion and blood viscosity. Also used as a transport protein that binds naturally occurring, therapeutic and toxic materials in circulation. |
Molecular Mass : | 66.5 kDa |
AA Sequence : | MKWVTFISLLFLFSSAYSRGVFRRDAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVT EFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRP EVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEG KASSAKQGLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADDRADL AKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVGSKDVCKNYAEAKDVFLGMFL YEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQL GEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAEDCLSVFLNQLCVLHEKTPV SDRVTKCCTESLVNGRPCFSALEVDETYVPKEFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKAT KEQLKAVMDDFAAFVEKCCKADDKETCFAEEGKKLV |
Endotoxin : | < 0.1 EU per μg of the protein |
Purity : | >95% |
Alias : | ALB; PRO0883; PRO0903; Albumin iodinated I-131 serum |
Gene Name | ALB albumin [ Homo sapiens ] |
Official Symbol | ALB |
Synonyms | ALB; albumin; serum albumin; albumin (32 AA); albumin (AA 34); growth-inhibiting protein 20; cell growth inhibiting protein 42; PRO0883; PRO0903; PRO1341; DKFZp779N1935; |
Gene ID | 213 |
mRNA Refseq | NM_000477 |
Protein Refseq | NP_000468 |
UniProt ID | P02768 |
Chromosome Location | 4q13.3 |
Pathway | Bile acid and bile salt metabolism, organism-specific biosystem; FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; HDL-mediated lipid transport, organism-specific biosystem; Hemostasis, organism-specific biosystem; Lipid digestion, mobilization, and transport, organism-specific biosystem; Lipoprotein metabolism, organism-specific biosystem; Metabolism, organism-specific biosystem; |
Function | DNA binding; antioxidant activity; cell surface binding; chaperone binding; copper ion binding; drug binding; drug binding; enzyme binding; fatty acid binding; fatty acid binding; metal ion binding; contributes_to oxygen binding; protein binding; pyridoxal phosphate binding; toxin binding; zinc ion binding; |
◆ Recombinant Proteins | ||
ALB-48H | Recombinant Human Albumin | +Inquiry |
ALB-0671R | Active Recombinant Rabbit ALB protein, His-tagged | +Inquiry |
Alb-234M | Recombinant Mouse Alb Protein | +Inquiry |
ALB-432H | Recombinant Human ALB Protein, GST-tagged | +Inquiry |
Alb-2196M | Recombinant Mouse Alb protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
ALB-293B | Native Bovine ALB Protein, TRITC-labeled | +Inquiry |
ALB-198B | Native Bovine ALB protein, methylated | +Inquiry |
ALB-314H | Native Human Albumin Fluorescein | +Inquiry |
Alb-109R | Native Rat Albumin | +Inquiry |
ALB-7993H | Native Human Serum Albumin(20% Solution) | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALB-8923HCL | Recombinant Human ALB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ALB Products
Required fields are marked with *
My Review for All ALB Products
Required fields are marked with *
0
Inquiry Basket