GMP Recombinant Porcine IGF1 Protein, His-Tagged

Cat.No. : IGF1-01P
Product Overview : GMP Recombinant Porcine IGF1 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Porcine
Source : E.coli
Tag : His
Description : Insulin-like growth factor 1 (IGF-1), also called somatomedin C, is a protein that in humans is encoded by the IGF1 gene. IGF-1 is a hormone similar in molecular structure to insulin. It plays an important role in childhood growth and continues to have anabolic effects in adults. A synthetic analog of IGF-1, mecasermin, is used for the treatment of growth failure.
Form : Lyophilized
AA Sequence : MGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA with polyhistidine tag at the C-terminus
Endotoxin : <0.1 EU per 1 μg of the protein by the LAL method.
Purity : >98% as determined by SDS-PAGE. Ni-NTA chromatography
Notes : Please use within one month after protein reconstitution.
Storage : Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Storage Buffer : The protein was lyophilized from a solution containing 1X PBS, pH 8.0.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Gene Name IGF1 insulin like growth factor 1 [ Sus scrofa (pig) ]
Official Symbol IGF1
Synonyms IGF-1; IGF-I; Npt2B
Gene ID 397491
mRNA Refseq NM_214256.1
Protein Refseq NP_999421.1
UniProt ID P16545

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IGF1 Products

Required fields are marked with *

My Review for All IGF1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon