GMP Recombinant Porcine IGF1 Protein, His-Tagged

• Cat.No.: IGF1-01P
• Product Overview: GMP Recombinant Porcine IGF1 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.

Specification

• Species: Porcine
• Source: E.coli
• Tag: His
• Description: Insulin-like growth factor 1 (IGF-1), also called somatomedin C, is a protein that in humans is encoded by the IGF1 gene. IGF-1 is a hormone similar in molecular structure to insulin. It plays an important role in childhood growth and continues to have anabolic effects in adults. A synthetic analog of IGF-1, mecasermin, is used for the treatment of growth failure.
• Form: Lyophilized
• AA Sequence: MGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA with polyhistidine tag at the C-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Purity: >98% as determined by SDS-PAGE. Ni-NTA chromatography
• Notes: Please use within one month after protein reconstitution.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 8.0.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Gene Information

• Gene Name: IGF1 insulin like growth factor 1 [ Sus scrofa (pig) ]
• Official Symbol: IGF1
• Synonyms: IGF-1; IGF-I; Npt2B
• Gene ID: 397491
• mRNA Refseq: NM_214256.1
• Protein Refseq: NP_999421.1
• UniProt ID: P16545