GMP Recombinant Porcine CXCL11 Protein, His-Tagged

• Cat.No.: CXCL11-01P
• Product Overview: GMP Recombinant Porcine CXCL11 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.

Specification

• Species: Porcine
• Source: E.coli
• Tag: His
• Description: CXCL11 has functional and structural relationship with CXCL9 and CXCL10. This CXC chemokine lacks a ELR (Glutamate-Leucine-Arginine) tripeptide motif.. Similar to CXCL9 and CXCL10, CXCL11 can specifically bind to the G protein-coupled receptor CXCR3 and involve in chemotaxis of immune cells and angiogenesis. Expression of both CXCR3 and CXCL11 by The Th1-associated cytokine IFNγ can express both CXCR3 and CXCL11 and create an amplification loop of cell-mediated immune response between Th1 cells
• Form: Lyophilized
• AA Sequence: FPMFKAGRCLCIGPGVKAVKVADIEKVSIIHPSNNCDKTEVIVTLKAHKGRRCLNPKSKQANVIMKKVERMNFLRYQNV with polyhistidine tag at the N-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Purity: >98% as determined by SDS-PAGE. Ni-NTA chromatography
• Notes: Please use within one month after protein reconstitution.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Gene Information

• Gene Name: CXCL11 C-X-C motif chemokine ligand 11 [ Sus scrofa (pig) ]
• Official Symbol: CXCL11
• Gene ID: 100169744
• mRNA Refseq: NM_001128491.1
• Protein Refseq: NP_001121963.1
• UniProt ID: B3GDY9