Recombinant Human CBR4, His-tagged

• Cat.No.: CBR4-26329TH
• Product Overview: Recombinant full length Human CBR4 with N terminal His tag; 257 amino acids with tag, Predicted MWt 27.5 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 237 amino acids
• Description: CBR4 belongs to the short-chain dehydrogenase/reductase family. The formation of heteroteramer with HSD17B8 has NADH-dependent 3-ketoacyl-acyl carrier protein reductase activity for o- and p-quinones.
• Conjugation: HIS
• Molecular Weight: 27.500kDa inclusive of tags
• Tissue specificity: Detected in liver and kidney (at protein level).
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 5mM DTT, 200mM Sodium chloride, 20mM Tris HCl, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMDKVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLEGAKAAAGDLGGDHLAFSCDVAKEHDVQNTFEEMEKHLGRVNFLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMIQQQGGSIVNVGSIVGLKGNSGQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGFVHTDMTKDLKEEHLKKNIPLGRFGETIEVAHAVVFLLESPYITGHVLVVDGGLQLIL
• Sequence Similarities: Belongs to the short-chain dehydrogenases/reductases (SDR) family.

Gene Information

• Gene Name: CBR4 carbonyl reductase 4 [ Homo sapiens ]
• Official Symbol: CBR4
• Synonyms: CBR4; carbonyl reductase 4; carbonyl reductase family member 4; FLJ14431; SDR45C1; short chain dehydrogenase/reductase family 45C; member 1
• Gene ID: 84869
• mRNA Refseq: NM_032783
• Protein Refseq: NP_116172
• Uniprot ID: Q8N4T8
• Chromosome Location: 4q32.3
• Function: NADPH binding; NADPH binding; NADPH dehydrogenase (quinone) activity; NADPH dehydrogenase (quinone) activity; nucleotide binding