Active Recombinant Human SLAMF7, Fc-tagged, Biotinylated
Cat.No. : | SLAMF7-688H |
Product Overview : | The recombinant human SLAMF7-Fc fusion protein is expressed as a 432-amino acid protein consisting of Ser23 - Met2250 region of SLAMF7 (UniProt accession #Q9NQ25) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 23-2250 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | Immobilized SLAMF7 interacts homophilically with SLAMF7 in a functional ELISA |
Molecular Mass : | Calculated molecular mass (kDa): 48.0; Estimated by SDS-PAGE under reducing condition (kDa): 60-70 |
AA Sequence : | SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKK NDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAA NESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSMSTGTHTCPPCPAPELLGGP SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQD WLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQ PENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Gene Name | SLAMF7 SLAM family member 7 [ Homo sapiens ] |
Official Symbol | SLAMF7 |
Synonyms | SLAMF7; SLAM family member 7; 19A; CD319; CRACC; CS1; protein 19A; CD2 subset 1; 19A24 protein; membrane protein FOAP-12; CD2-like receptor activating cytotoxic cells; CD2-like receptor-activating cytotoxic cells; novel LY9 (lymphocyte antigen 9) like protein; |
Gene ID | 57823 |
mRNA Refseq | NM_021181 |
Protein Refseq | NP_067004 |
MIM | 606625 |
UniProt ID | Q9NQ25 |
Chromosome Location | 1q23.1-q24.1 |
Function | receptor activity; |
◆ Recombinant Proteins | ||
SLAMF7-0692H | Recombinant Human SLAMF7 protein, hFc-tagged | +Inquiry |
SLAMF7-352M | Recombinant Mouse SLAMF7 protein, Mouse IgG2a Fc-tagged, low endotoxin | +Inquiry |
SLAMF7-170R | Recombinant Rhesus Macaque SLAMF7(Ser23-Met226) Protein, C-6*His-tagged | +Inquiry |
SLAMF7-19H | Recombinant Human SLAMF7 protein, GST-tagged | +Inquiry |
SLAMF7-6102H | Recombinant Human SLAMF7 Protein (Ser23-Ser225), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLAMF7-2591MCL | Recombinant Mouse SLAMF7 cell lysate | +Inquiry |
SLAMF7-2378HCL | Recombinant Human SLAMF7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLAMF7 Products
Required fields are marked with *
My Review for All SLAMF7 Products
Required fields are marked with *
0
Inquiry Basket