Recombinant Human SLAMF7 protein, GST-tagged

• Cat.No.: SLAMF7-19H
• Product Overview: Recombinant Human SLAMF7(1 a.a. - 296 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Description: SLAMF7 played an impotant role in many functions.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 58.3 kDa
• Protein length: 1 a.a. - 296 a.a.
• AA Sequence: MAGSPTCLTLIYILWQLTGSAASGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSMVLLCLPLVPLLLSLFVLGLFLWFLKRERQEENNPKGRSSKYGLLHCGNTEKDGKSPLTAHDARHTKAICL
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: SLAMF7 SLAM family member 7 [ Homo sapiens ]
• Official Symbol: SLAMF7
• Synonyms: SLAMF7; SLAM family member 7; 19A; CD319; CRACC; CS1; protein 19A; CD2 subset 1; 19A24 protein; membrane protein FOAP-12; CD2-like receptor activating cytotoxic cells; CD2-like receptor-activating cytotoxic cells; novel LY9 (lymphocyte antigen 9) like protein
• Gene ID: 57823
• mRNA Refseq: NM_021181
• Protein Refseq: NP_067004
• MIM: 606625
• UniProt ID: Q9NQ25
• Chromosome Location: 1q23.1-q24.1
• Function: receptor activity