Recombinant E.coli Mug, His-tagged

• Cat.No.: mug-93E
• Product Overview: Recombinant E. coli G/U Mismatch-Specific DNA Glycosylase/Mug is produced with our E.coli expression system. The target protein is expressed with sequence (Met1-Arg168) of E.coli Mug.

Specification

• Species: E.coli
• Source: E.coli
• Tag: His
• Protein Length: 1-168 a.a.
• Description: E. coli Mismatch Uracil DNA Glycosylase (Mug protein), also known as G/U mismatch-specific DNA glycosylase, is an 18 kDa constitutively expressed protein which belongs to the TDG/mug DNA glycosylase family. It has been proposed that the Mug protein excises 3,N4-ethenocytosine and removes the uracil base from mismatches in the order of U:G>U:A, although the biological role remains unclear. Uracil bases in DNA can arise from deamination of cytosine giving rise to increased spontaneous mutations. The enzyme Uracil-N-Glycosylase removes uracil from the DNA leaving an AP site. It is capable of hydrolyzing the carbon-nitrogen bond between the sugar-phosphate backbone of the DNA and the mispaired base. The complementary strand guanine functions in substrate recognition. Required for DNA damage lesion repair in stationary-phase cells.
• Form: Supplied as a 0.2 μM filtered solution of 20mM Tris-HCl, 2.5mM β-ME, 1mM PMSF, 50% Glycerol, pH 8.0
• AA Sequence: MVEDILAPGLRVVFCGINPGLSSAGTGFPFAHPANRFWKVIYQAGFTDRQLKPQEAQHLLDYRCG VTKLVDRPTVQANEVSKQELHAGGRKLIEKIEDYQPQALAILGKQAYEQGFSQRGAQWGKQTLTI GSTQIWVLPNPSGLSRVSLEKLVEAYRELDQALVVRGRLEHHHHHH
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Store at < -20°C, stable for 6 months after receipt.Please minimize freeze-thaw cycles.