Recombinant E.coli Mug, His-tagged

Cat.No. : mug-93E
Product Overview : Recombinant E. coli G/U Mismatch-Specific DNA Glycosylase/Mug is produced with our E.coli expression system. The target protein is expressed with sequence (Met1-Arg168) of E.coli Mug.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : E.coli
Source : E.coli
Tag : His
Protein Length : 1-168 a.a.
Description : E. coli Mismatch Uracil DNA Glycosylase (Mug protein), also known as G/U mismatch-specific DNA glycosylase, is an 18 kDa constitutively expressed protein which belongs to the TDG/mug DNA glycosylase family. It has been proposed that the Mug protein excises 3,N4-ethenocytosine and removes the uracil base from mismatches in the order of U:G>U:A, although the biological role remains unclear. Uracil bases in DNA can arise from deamination of cytosine giving rise to increased spontaneous mutations. The enzyme Uracil-N-Glycosylase removes uracil from the DNA leaving an AP site. It is capable of hydrolyzing the carbon-nitrogen bond between the sugar-phosphate backbone of the DNA and the mispaired base. The complementary strand guanine functions in substrate recognition. Required for DNA damage lesion repair in stationary-phase cells.
Form : Supplied as a 0.2 μM filtered solution of 20mM Tris-HCl, 2.5mM β-ME, 1mM PMSF, 50% Glycerol, pH 8.0
AA Sequence : MVEDILAPGLRVVFCGINPGLSSAGTGFPFAHPANRFWKVIYQAGFTDRQLKPQEAQHLLDYRCG VTKLVDRPTVQANEVSKQELHAGGRKLIEKIEDYQPQALAILGKQAYEQGFSQRGAQWGKQTLTI GSTQIWVLPNPSGLSRVSLEKLVEAYRELDQALVVRGRLEHHHHHH
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Store at < -20°C, stable for 6 months after receipt.Please minimize freeze-thaw cycles.

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All mug Products

Required fields are marked with *

My Review for All mug Products

Required fields are marked with *

0

Inquiry Basket

cartIcon