Recombinant Human NEU1, His-tagged

Cat.No. : NEU1-156H
Product Overview : Recombinant Human Sialidase-1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Glu48-Leu415) of Human NEU1 fused with a 6His tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Description : Sialidase-1 belongs to the N-acetyl-a neuraminidase family. Sialidase-1 is expressed in many tissues; it is highly expressed in the pancreas, and weakly expressed in the brain. Sialidase-1 is a lysosomal enzyme, which cleaves terminal sialic acid residues from substrates such as glycoproteins and glycolipids. Deficiencies in the human enzyme Sialidase-1 leads to sialidosis, a rare lysosomal storage disease. Sialidase-1 has been shown to interact with Cathepsin A (protective protein), β-galactosidase and N-acetylgalactosamine-6-sulfate sulfatase in a multienzyme complex.
AA Sequence : ENDFGLVQPLVTMEQLLWVSGRQIGSVDTFRIPLITATPRGTLLAFAEARKMSSSDEGAKFIALR RSMDQGSTWSPTAFIVNDGDVPDGLNLGAVVSDVETGVVFLFYSLCAHKAGCQVASTMLVWSKDD GVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGASWRY GSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACDTLRPRDV TFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWRKETVQLWPGPSGYSS LATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTLVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Publications :
Neuraminidases 1 and 3 Trigger Atherosclerosis by Desialylating Low‐Density Lipoproteins and Increasing Their Uptake by Macrophages (2021)
Gene Name NEU1 sialidase 1 (lysosomal sialidase) [ Homo sapiens ]
Official Symbol NEU1
Synonyms NEU1; sialidase 1 (lysosomal sialidase); NEU; sialidase-1; G9 sialidase; exo-alpha-sialidase; lysosomal sialidase; acetylneuraminyl hydrolase; N-acetyl-alpha-neuraminidase 1; NANH; SIAL1; FLJ93471;
Gene ID 4758
mRNA Refseq NM_000434
Protein Refseq NP_000425
MIM 608272
UniProt ID Q99519
Chromosome Location 6p21
Pathway Glycosphingolipid metabolism, organism-specific biosystem; Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; Metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Other glycan degradation, organism-specific biosystem; Other glycan degradation, conserved biosystem;
Function exo-alpha-(2->3)-sialidase activity; exo-alpha-(2->6)-sialidase activity; exo-alpha-(2->8)-sialidase activity; exo-alpha-sialidase activity; hydrolase activity, acting on glycosyl bonds;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NEU1 Products

Required fields are marked with *

My Review for All NEU1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon