Recombinant Human NEU1, His-tagged
Cat.No. : | NEU1-156H |
Product Overview : | Recombinant Human Sialidase-1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Glu48-Leu415) of Human NEU1 fused with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | Sialidase-1 belongs to the N-acetyl-a neuraminidase family. Sialidase-1 is expressed in many tissues; it is highly expressed in the pancreas, and weakly expressed in the brain. Sialidase-1 is a lysosomal enzyme, which cleaves terminal sialic acid residues from substrates such as glycoproteins and glycolipids. Deficiencies in the human enzyme Sialidase-1 leads to sialidosis, a rare lysosomal storage disease. Sialidase-1 has been shown to interact with Cathepsin A (protective protein), β-galactosidase and N-acetylgalactosamine-6-sulfate sulfatase in a multienzyme complex. |
AA Sequence : | ENDFGLVQPLVTMEQLLWVSGRQIGSVDTFRIPLITATPRGTLLAFAEARKMSSSDEGAKFIALR RSMDQGSTWSPTAFIVNDGDVPDGLNLGAVVSDVETGVVFLFYSLCAHKAGCQVASTMLVWSKDD GVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGASWRY GSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACDTLRPRDV TFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWRKETVQLWPGPSGYSS LATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTLVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Publications : |
Neuraminidases 1 and 3 Trigger Atherosclerosis by Desialylating Low‐Density Lipoproteins and Increasing Their Uptake by Macrophages (2021)
|
Gene Name | NEU1 sialidase 1 (lysosomal sialidase) [ Homo sapiens ] |
Official Symbol | NEU1 |
Synonyms | NEU1; sialidase 1 (lysosomal sialidase); NEU; sialidase-1; G9 sialidase; exo-alpha-sialidase; lysosomal sialidase; acetylneuraminyl hydrolase; N-acetyl-alpha-neuraminidase 1; NANH; SIAL1; FLJ93471; |
Gene ID | 4758 |
mRNA Refseq | NM_000434 |
Protein Refseq | NP_000425 |
MIM | 608272 |
UniProt ID | Q99519 |
Chromosome Location | 6p21 |
Pathway | Glycosphingolipid metabolism, organism-specific biosystem; Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; Metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Other glycan degradation, organism-specific biosystem; Other glycan degradation, conserved biosystem; |
Function | exo-alpha-(2->3)-sialidase activity; exo-alpha-(2->6)-sialidase activity; exo-alpha-(2->8)-sialidase activity; exo-alpha-sialidase activity; hydrolase activity, acting on glycosyl bonds; |
◆ Recombinant Proteins | ||
NEU1-178HFL | Active Recombinant Full Length Human NEU1 Protein, C-Flag-tagged | +Inquiry |
Neu1-5480M | Recombinant Mouse Neu1 protein, His-tagged | +Inquiry |
NEU1-323H | Recombinant Human NEU1 Protein, His-tagged | +Inquiry |
NEU1-5667H | Recombinant Human NEU1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NEU1-1501H | Recombinant Human NEU1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NEU1-3871HCL | Recombinant Human NEU1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NEU1 Products
Required fields are marked with *
My Review for All NEU1 Products
Required fields are marked with *
0
Inquiry Basket