Recombinant Human DPEP1, His-tagged
Cat.No. : | DPEP1-77H |
Product Overview : | Recombinant Human Dipeptidase 1/DPEP1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Asp17-Ser385) of Human DPEP1 fused with a 6His tag at the C-terminus. |
Availability | April 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 17-385 a.a. |
Description : | Dipeptidase 1 (DPEP1) is a kidney membrane enzyme that belongs to the peptidase M19 family. DPEP1 is a homodimer and is inhibited by L-penicillamine. DPEP1 hydrolyzes a variety of dipeptides and is implicated in renal metabolism of glutathione and its conjugates. DPEP1 is responsible for hydrolysis of the beta-lactam ring of antibiotics, such as penem and carbapenem. DPEP1 may play an important role in the regulation of leukotriene activity. DPEP1 expression in cancer is significantly higher than that in normal tissue. However, DPEP1 expression decreased with pathological differentiation, lymph-node and distant metastasis. |
AA Sequence : | DFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFW SVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSI DSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLID LAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTN KANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGA LADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSSVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Publications : |
Pulmonary Delivery of Engineered Exosomes to Suppress Postoperative Melanoma Lung Metastasis through Preventing Premetastatic Niche Formation (2021)
|
◆ Recombinant Proteins | ||
DPEP1-5225S | Recombinant Sheep DPEP1 protein, His-tagged | +Inquiry |
DPEP1-5633H | Recombinant Human DPEP1 protein, His-tagged | +Inquiry |
DPEP1-1318R | Recombinant Rhesus monkey DPEP1 Protein, His-tagged | +Inquiry |
DPEP1-1595R | Recombinant Rat DPEP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DPEP1-1982H | Recombinant Human DPEP1 Protein (Asp17-Ser385), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DPEP1-1178HCL | Recombinant Human DPEP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DPEP1 Products
Required fields are marked with *
My Review for All DPEP1 Products
Required fields are marked with *
0
Inquiry Basket