Recombinant Human ACVR1

• Cat.No.: ACVR1-9172H
• Product Overview: Recombinant Human ACVR1, was expressed in Baculovirus-Insect cells

Specification

• Species: Human
• Source: Insect Cells
• Tag: Non
• Protein Length: 123 amino acids
• Description: Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I ( I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. This gene encodes activin A type I receptor which signals a particular transcriptional response in concert with activin type II receptors. Mutations in this gene are associated with fibrodysplasia ossificans progressive.
• Form: Lyophilized. 25 mM Tris-HCl, pH7.4, 300 mM NaCl ,1 mM DTT, 5%Trehalose
• Molecular Mass: Has a calculated molecular mass of 13.5KDa. It migrates as an approximately 17kDa band in SDS-PAGE under reducing conditions.
• AA Sequence: MVDGVMILPVLIMIALPSPSMEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYE QGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLE
• Purity: >93% as determined by SDS-PAGE
• Storage: Store it at +4℃ for short term. For long term storage, store it at -20℃ ～ -70℃
• Reconstitution: It is recommended to reconstitute the lyophilized ACVR1 in 0.1～0.2ml sterile and pre-cooled ddH2O, which can then be further diluted to other aqueous solutions.

Gene Information

• Gene Name: ACVR1 activin A receptor, type I [ Homo sapiens ]
• Official Symbol: ACVR1
• Synonyms: ACVR1; activin A receptor, type I; ACVRLK2; activin receptor type-1; ACVR1A; ALK2; SKR1; activin receptor type I; hydroxyalkyl-protein kinase; activin receptor-like kinase 2; TGF-B superfamily receptor type I; activin A receptor, type II-like kinase 2; serine/threonine-protein kinase receptor R1; FOP; TSRI; ACTRI
• Gene ID: 90
• mRNA Refseq: NM_001105
• Protein Refseq: NP_001096
• MIM: 102576
• UniProt ID: Q04771
• Chromosome Location: 2q23-q24
• Pathway: ALK1 pathway, organism-specific biosystem; ALK1 signaling events, organism-specific biosystem; ALK2 signaling events, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem
• Function: ATP binding; SMAD binding; activin binding; contributes_to activin receptor activity, type I; follistatin binding; metal ion binding; nucleotide binding; protein binding; protein homodimerization activity; protein serine/threonine kinase activity; receptor activity; receptor signaling protein serine/threonine kinase activity; transforming growth factor beta binding; transforming growth factor beta receptor activity, type I; transmembrane receptor protein serine/threonine kinase activity