Recombinant Human DEFB103A protein

Cat.No. : DEFB103A-84H
Product Overview : Recombinant Human DEFB103A protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 45
Description : Defensins (alpha and beta) are cationic peptides with antimicrobial activity against Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses. They are 2-6 kDa proteins and take important roles in innate immune system. On the basis of their size and pattern of disulfide bonding, mammalian defensins are classified into alpha, beta and theta categories. β-Defensins contain a six-cysteine motif that forms three intra-molecular disulfide bonds. Four human β-defensins have been identified and they are expressed on some leukocytes and at epithelial surfaces. Because β-defensins is cationic peptides, they can therefore interact with the membrane of invading microbes, which are negative due to lipopolysaccharides (LPS) and lipoteichoic acid (LTA) found in the cell membrane. Especially, they have higher affinity to the binding site compared to Ca2+ and Mg2+ ions. Furthermore, they can affect the stability of the membrane.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 130 mM NaCl.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by anti-microbial activity against E.coli. is less than 30 μg/ml, corresponding to a specific activity of > 33.3 IU/mg.
Molecular Mass : Approximately 5.2 kDa, a single non-glycosylated polypeptide chain containing 45 amino acids.
AA Sequence : GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK
Endotoxin : Less than 1 EU/µg of rHuBD-3 as determined by LAL method.
Purity : >98% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name DEFB103A
Official Symbol DEFB103A
Synonyms DEFB103A; defensin, beta 103A; DEFB3, DEFB103, defensin, beta 3; beta-defensin 103; DEFB 3; HBD 3; HBD3; HBP 3; HBP3; beta-defensin 3; defensin, beta 3; defensin, beta 103; defensin-like protein; BD-3; DEFB3; HBP-3; hBD-3; DEFB-3; DEFB103;
Gene ID 414325
mRNA Refseq NM_001081551
Protein Refseq NP_001075020
MIM 606611
UniProt ID P81534

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DEFB103A Products

Required fields are marked with *

My Review for All DEFB103A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon