Recombinant Human DEFB103A Protein
Cat.No. : | DEFB103A-69H |
Product Overview : | Recombinant Human DEFB103A Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Beta-Defensin 3 (BD-3), also known as DEFB-3, is a member of the defensin class of antimicrobial peptides. Beta defensins exert host defense responses against viruses, bacteria, and fungi through the binding and permeabilizing of microbial membranes. BD-3 expression is stimulated by interferon-gamma and is an important molecule during adaptive immunity. BD-3 functions to activate monocytes and mast cells, and has antibacterial functions towards Gram-negative and Gram-positive bacteria. Further, BD-3 blocks human immunodeficiency virus type 1 (HIV-1) replication through the downregulation of the HIV-1 co-receptor, CXCR4. |
Bio-activity : | No biological activity data is available at this time. |
Molecular Mass : | Monomer, 5.2 kDa (45 aa) |
AA Sequence : | GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile 10 mM acetic acid at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | DEFB103A defensin, beta 103A [ Homo sapiens (human) ] |
Official Symbol | DEFB103A |
Synonyms | DEFB103A; defensin, beta 103A; DEFB3, DEFB103, defensin, beta 3; beta-defensin 103; DEFB 3; HBD 3; HBD3; HBP 3; HBP3; beta-defensin 3; defensin, beta 3; defensin, beta 103; defensin-like protein; BD-3; DEFB3; HBP-3; hBD-3; DEFB-3; DEFB103; |
Gene ID | 414325 |
mRNA Refseq | NM_001081551 |
Protein Refseq | NP_001075020 |
UniProt ID | P81534 |
◆ Recombinant Proteins | ||
DEFB103A-541H | Active Recombinant Human DEFB103A Protein | +Inquiry |
DEFB103A-2522H | Recombinant Human DEFB103A Protein, GST-tagged | +Inquiry |
DEFB103A-2431HF | Recombinant Full Length Human DEFB103A Protein, GST-tagged | +Inquiry |
DEFB103A-84H | Recombinant Human DEFB103A protein | +Inquiry |
DEFB103A-301628H | Recombinant Human DEFB103A protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DEFB103A-464HCL | Recombinant Human DEFB103A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DEFB103A Products
Required fields are marked with *
My Review for All DEFB103A Products
Required fields are marked with *
0
Inquiry Basket