Recombinant Human CCL18 protein

Description :	Human CCL18 is encoded by the CCL18 gene located on the chromosome 17. As also named MIP-4, it shares 61 % sequence identity to human MIP-1α. CCL18 is mainly expressed by lung and some lymphoid tissues like lymph nodes express CCL18 at low level. It is chemotactic for both activated (CD3+) T cells and nonactivated (CD14-) lymphocytes, but not for monocytes or granulocytes. Involved in B-cell migration into B-cell follicles in lymph nodes. CCL18 plays a role in both humoral and cell-mediated immunity responses.
Source :	E.coli
Species :	Human
Form :	Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 100 mM NaCl.
Bio-activity :	Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration of 1.0-10 ng/ml.
Molecular Mass :	Approximately 7.9 kDa, a single non-glycosylated polypeptide chain containing 69 amino acids.
Protein length :	69
AA Sequence :	AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA
Endotoxin :	Less than 1 EU/μg of rHuMIP-4/CCL18 as determined by LAL method.
Purity :	>97% by SDS-PAGE and HPLC analysis.
Storage :	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution :	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Tag :	Non

Gene Name	CCL18
Official Symbol	CCL18
Synonyms	CCL18; chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated); SCYA18, small inducible cytokine subfamily A (Cys Cys), member 18, pulmonary and activation regulated; C-C motif chemokine 18; AMAC 1; CKb7; DC CK1; DCCK1; MIP 4; PARC; CC chemokine PARC; CC chemokine ligand 18; chemokine (C-C), dendritic; dendritic cell chemokine 1; small inducible cytokine A18; small-inducible cytokine A18; macrophage inflammatory protein 4; pulmonary and activation-regulated chemokine; alternative macrophage activation-associated CC chemokine 1; small inducible cytokine subfamily A (Cys-Cys), member 18, pulmonary and activation-regulated; AMAC1; MIP-4; AMAC-1; DC-CK1; SCYA18;
Gene ID	6362
mRNA Refseq	NM_002988
Protein Refseq	NP_002979
MIM	603757
UniProt ID	P55774