Active Recombinant Rat Vegf165 Protein

• Cat.No.: Vegfa-199V
• Product Overview: Recombinant Rat Vegf165 Protein without tag was expressed in CHO.

Specification

• Species: Rat
• Source: CHO
• Description: Vascular Endothelial Growth Factor (VEGF) is a potent growth and angiogenic cytokine. It stimulates proliferation and survival of endothelial cells, and promotes angiogenesis and vascular permeability. Expressed in vascularized tissues, Vascular Endothelial Growth Factor (VEGF) plays a prominent role in normal and pathological angiogenesis. Substantial evidence implicates Vascular Endothelial Growth Factor (VEGF) in the induction of tumor metastasis and intra-ocular neovascular syndromes. Vascular Endothelial Growth Factor (VEGF) signals through the three receptors; fms-like tyrosine kinase (flt-1), KDR gene product (the murine homolog of KDR is the flk-1 gene product) and the flt4 gene product.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 4 ng/mL, measured in a cell proliferation assay using HUVEC cells, corresponding to a specific activity of >2.5 5 units/mg
• Molecular Mass: 35-48 kDa, observed by non-reducing SDS-PAGE.
• AA Sequence: APTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Storage: Lyophilized recombinant Rat Vascular Endothelial Growth Factor 165 (VEGF165) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rrVEGF165 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: Vegfa vascular endothelial growth factor A [ Rattus norvegicus ]
• Official Symbol: Vegfa
• Synonyms: VEGFA; vascular endothelial growth factor A; VPF; VEGF-A; vascular permeability factor; Vegf; VEGF164
• Gene ID: 83785
• mRNA Refseq: NM_001110333
• Protein Refseq: NP_001103803
• UniProt ID: P16612