Active Recombinant Human VEGFA Protein

• Cat.No.: VEGFA-01H
• Product Overview: Recombinant Human VEGF-165 Protein without tag was expressed in Nicotiana Benthamiana. Animal Component Free. Low endotoxins, prions or virons to risk microbial contamination.

Specification

• Species: Human
• Source: Nicotiana Benthamiana
• Form: VEGF-165 delivered soluble/frozen carrier-free. Does not contain BSA.
• Bio-activity: ED50 = 2.3 ng/mL
• Molecular Mass: Recombinant human VEGF-165 produced in plants contains 165 amino acids and has a predicted molecular mass of 19.2 kDa. The predicted mass of the dimer is 38.4 kDa. As a result of glycosylation, the recombinant protein migrates with an apparent molecular mass of 26.28 kDa in SDS-PAGE.
• AA Sequence: APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
• Endotoxin: Low endotoxins, prions or virons to risk microbial contamination.
• Purity: > 95%, as determined by SDS-Page
• Stability: Recombinant Proteins are stable for up to 6 months from date of receipt at -20 centigrade, one year at -80 centigrade.
• Storage: Until use, Human VEGF-165 should be stored at 4 centigrade between 2-7 days and for future use below -18 centigrade. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

Gene Information

• Gene Name: VEGFA vascular endothelial growth factor A [ Homo sapiens (human) ]
• Official Symbol: VEGFA
• Synonyms: VEGFA; vascular endothelial growth factor A; VPF; VEGF; MVCD1; vascular endothelial growth factor A; vascular endothelial growth factor A121; vascular endothelial growth factor A165; vascular permeability factor
• Gene ID: 7422
• mRNA Refseq: NM_003376
• Protein Refseq: NP_003367
• MIM: 192240
• UniProt ID: P15692