Active Recombinant Rat Tnf Protein (157 aa)

• Cat.No.: Tnf-003T
• Product Overview: Recombinant Rat Tnf Protein without tag was expressed in E. coli.

Specification

• Species: Rat
• Source: E.coli
• Protein Length: 157
• Description: Tumor necrosis factor alpha (TNF-α), also called cachectin, is produced by neutrophils, activated lymphocytes, macrophages, NK cells, LAK cells, astrocytes endothelial cells, smooth muscle cells and some transformed cells. TNF-α occurs as a secreted, soluble form and as a membrane-anchored form, both of which are biologically active. The naturally-occurring form of TNF-α is glycosylated, but non-glycosylated recombinant TNF-α has comparable biological activity. The biologically active native form of TNF-α is reportedly a trimer. Two types of receptors for TNF-α have been described and virtually all cell types studied show the presence of one or both of these receptor types.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: Fully biologically active when compared to standard. The Specific Activity is ≥5.0 × 10^7 IU/mg as determined by the cytolysis of murine L929 cells in the presence of Actinomycin D.
• Molecular Mass: Approximately 17.3 kDa. a single, non-glycosylated polypeptide chain containing 157 amino acids.
• AA Sequence: MLRSSSQNSSDKPVVHVVANHQAEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLIYSQVLFKGQGCPDYVLLTHTVSRFATSYQEKVSLLSAIKSPCPKDTPEGAELKPWYEPMYLGGVSQLEKGDLLSAEVNLPKYLDITESGQVYFGVIAL
• Endotoxin: Less than 1 EU/mg of rRtTNF-α as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
• Storage Buffer: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH7.2, 150mM NaCl.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Tnf tumor necrosis factor [ Rattus norvegicus ]
• Official Symbol: Tnf
• Synonyms: TNF; tumor necrosis factor; cachectin; tumor necrosis factor alpha; tumor necrosis factor (TNF superfamily, member 2); tumor necrosis factor ligand superfamily member 2; Tnfa; RATTNF; TNF-alpha; MGC124630
• Gene ID: 24835
• mRNA Refseq: NM_012675
• Protein Refseq: NP_036807
• UniProt ID: P16599