Active Recombinant Rat Ppbp Protein (62 aa)

Cat.No. : Ppbp-204P
Product Overview : Recombinant rat Thymus Chemokine-1/CXCL7 produced in CHO cells is a polypeptide chain containing 62 amino acids. A fully biologically active molecule, rrThymus Chemokine-1/CXCL7 has a molecular mass of 9.8 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : CHO
Protein Length : 62
Description : Thymus Chemokine-1, also called Chemokine (C-X-C motif) ligand 7 (CXCL7), is a member of the CXC chemokines. Similar to other ELR domain containing CXC chemokines such as IL-8 and the GRO proteins, Thymus Chemokine-1 has been shown to bind CXCR-2 and be a chemoattractant forneutrophils and play a role in their activation. Although CTAP-III, β-TG and PBP represent amino-terminal extended variants of Thymus Chemokine-1 and possess the same CXC chemokine domains, these proteins do not exhibit Thymus Chemokine-1 activity. Recently, it has been shown that the additional amino-terminal residues of CTAP-III mask the critical ELR receptor binding domain that is exposed on Thymus Chemokine-1 and may account for lack of Thymus Chemokine-1 activity. Rat CXCL7 shares 72% amino acid sequence identity with mouse CXCL7.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : The EC50 value of rat Thymus Chemokine-1/CXCL7 on Ca^2+ mobilization assay in CHO-K1/Gα15/rCXCR2 cells (human Gα15 and rat CXCR2 stably expressed in CHO-K1 cells) is less than 300 ng/mL.
Molecular Mass : 9.8 kDa, observed by reducing SDS-PAGE.
AA Sequence : IELRCRCTNTLSGIPLNSISRVNVFRPGAHCDNVEVIATLKNGKEVCLDPTAPMIKKIVKKI
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 97% as analyzed by SDS-PAGE and HPLC.
Storage : Lyophilized recombinant Rat Thymus Chemokine-1/CXCL7 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Rat Thymus Chemokine-1/CXCL7 should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name Ppbp pro-platelet basic protein [ Rattus norvegicus (Norway rat) ]
Official Symbol Ppbp
Synonyms Ppbp; pro-platelet basic protein; Cxcl7; Nap-2; platelet basic protein; chemokine (C-X-C motif) ligand 7; neutrophil activating peptide-2
Gene ID 246358
mRNA Refseq NM_153721
Protein Refseq NP_714943
UniProt ID Q99ME0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Ppbp Products

Required fields are marked with *

My Review for All Ppbp Products

Required fields are marked with *

0

Inquiry Basket

cartIcon