Active Recombinant Rat Ppbp Protein (62 aa)

• Cat.No.: Ppbp-204P
• Product Overview: Recombinant rat Thymus Chemokine-1/CXCL7 produced in CHO cells is a polypeptide chain containing 62 amino acids. A fully biologically active molecule, rrThymus Chemokine-1/CXCL7 has a molecular mass of 9.8 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.

Specification

• Species: Rat
• Source: CHO
• Protein Length: 62
• Description: Thymus Chemokine-1, also called Chemokine (C-X-C motif) ligand 7 (CXCL7), is a member of the CXC chemokines. Similar to other ELR domain containing CXC chemokines such as IL-8 and the GRO proteins, Thymus Chemokine-1 has been shown to bind CXCR-2 and be a chemoattractant forneutrophils and play a role in their activation. Although CTAP-III, β-TG and PBP represent amino-terminal extended variants of Thymus Chemokine-1 and possess the same CXC chemokine domains, these proteins do not exhibit Thymus Chemokine-1 activity. Recently, it has been shown that the additional amino-terminal residues of CTAP-III mask the critical ELR receptor binding domain that is exposed on Thymus Chemokine-1 and may account for lack of Thymus Chemokine-1 activity. Rat CXCL7 shares 72% amino acid sequence identity with mouse CXCL7.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: The EC50 value of rat Thymus Chemokine-1/CXCL7 on Ca^2+ mobilization assay in CHO-K1/Gα15/rCXCR2 cells (human Gα15 and rat CXCR2 stably expressed in CHO-K1 cells) is less than 300 ng/mL.
• Molecular Mass: 9.8 kDa, observed by reducing SDS-PAGE.
• AA Sequence: IELRCRCTNTLSGIPLNSISRVNVFRPGAHCDNVEVIATLKNGKEVCLDPTAPMIKKIVKKI
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 97% as analyzed by SDS-PAGE and HPLC.
• Storage: Lyophilized recombinant Rat Thymus Chemokine-1/CXCL7 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Rat Thymus Chemokine-1/CXCL7 should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: Ppbp pro-platelet basic protein [ Rattus norvegicus (Norway rat) ]
• Official Symbol: Ppbp
• Synonyms: Ppbp; pro-platelet basic protein; Cxcl7; Nap-2; platelet basic protein; chemokine (C-X-C motif) ligand 7; neutrophil activating peptide-2
• Gene ID: 246358
• mRNA Refseq: NM_153721
• Protein Refseq: NP_714943
• UniProt ID: Q99ME0