Active Recombinant Rat Il18 Protein (159 aa)
Cat.No. : | Il18-368I |
Product Overview : | Recombinant rat Interleukin-18 (rrIL-18) produced in E. coli is a single non-glycosylated polypeptide chain containing 159 amino acids. A fully biologically active molecule, rrIL-18 has a molecular mass of 18.4 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Protein Length : | 159 |
Description : | Interleukin-18 (IL18, also known as interferon-gamma inducing factor or IGIF) is a cytokine that belongs to the IL-1 superfamily and is produced by macrophages and other cells. Its biological activity is pleiotropic and it has been shown to induce interferon-gamma production in KG-1 cells. The combination of this cytokine and IL12 has been shown to inhibit IL4 dependent IgE and IgG1 production, and enhance IgG2a production in B cells. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 2 μg/mL resulted in the secretion of 0.15 ng/mL h-IFN-gamma when tested using KG-1 cell line, corresponding to a specific activity of > 500 units/mg. |
Molecular Mass : | 18.4 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | MHFGRLHCTTAVIRSINDQVLFVDKRNPPVFEDMPDIDRTANESQTRLIIYMYKDSEVRGLAVTLSVKDGRMSTLSCKNKIISFEEMNPPENIDDIKSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLVLKRKDENGDKSVMFTLTNLHQS |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% by SDS-PAGE analyses. |
Storage : | Lyophilized recombinant ratInterleukin-18 (rrIL-18) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rrIL-18 should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against 50mM Tris, 50mM NaCl, pH8.0. |
Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
Gene Name | Il18 interleukin 18 [ Rattus norvegicus ] |
Official Symbol | Il18 |
Synonyms | IL18; interleukin 18; interleukin-18; IL-1 gamma; interleukin-1 gamma; IFN-gamma-inducing factor; interferon gamma-inducing factor; interferon-gamma-inducing factor; IL-18; |
Gene ID | 29197 |
mRNA Refseq | NM_019165 |
Protein Refseq | NP_062038 |
UniProt ID | P97636 |
◆ Recombinant Proteins | ||
IL18-334R | Recombinant Rhesus IL18 protein, His-tagged | +Inquiry |
IL18-3681H | Recombinant Human IL18 protein(Met1-Asp193), GST-tagged | +Inquiry |
IL18-01D | Recombinant Dog Interleukin-18 | +Inquiry |
IL18-183H | Active Recombinant Human IL18 Protein (Tyr37-Asp193), Animal-free, Carrier-free | +Inquiry |
IL18-875C | Recombinant Chicken IL18 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL18-344HCL | Recombinant Human IL18 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (1)
Ask a questionIL18-01HG: Sequence: a.a.37-193 Endotoxin: <20 EU/mg Bio-activity: >5.0 x 10^4 IU/mg QC: Activity test, SDS-PAGE, LAL, SEC-HPLC IL18-153HG: Protein length: Tyr37-Asp193 AA Sequence: YFGKLESKLS VIRNLNDQVL FIDQGNRPLF EDMTDSDCRD NAPRTIFIISMYKDSQPRGM AVTISVKCEK ISTLSCENKI ISFKEMNPPD NIKDTKSDIIFFQRSVPGHD NKMQFESSSY EGYFLACEKE RDLFKLILKK EDELGDRSIMFTVQNEDVD Bio-activity: 1.0*10^6IU Measured by its ability to induce IFN-gamma secretion by KG‐1 human acute myelogenous leukemia cells in the presence of TNF-alpha. QC: Activity test, SDS-PAGE, LAL IL18-500H Recombinant Human IL18 will be custom produced upon order. All the sequence, purity, activity, and QC procedures will be optional and decided by our customer.
Ask a Question for All Il18 Products
Required fields are marked with *
My Review for All Il18 Products
Required fields are marked with *
Inquiry Basket