Recombinant Dog Interleukin-18

• Cat.No.: IL18-01D

Specification

• Species: Dog
• Source: E.coli
• Tag: Non
• Form: 20 mM Tris-HCl, 100 mM NaCl, 1 mM DTT, 5% Trehalose, pH7.4.
• Molecular Mass: ~18kDa
• AA Sequence: YFGKLEPKLSIIRNLNDQVLFVNEGNQPVFEDMPDSDCTDNAPHTIFIIYMYKDSLTRGLAVTISVKYKTMSTLS CKNKTISFQKMSPPDSINDEGNDIIFFQRSVPGHDDKIQFESSLYKGHFLACKKENDLFKLILKDKDENGDKSIM FTVQNKS
• Purity: >95% as determined by SDS-PAGE
• Storage: Short Term Storage +4°C, Long Term Storage -20°C. After reconstitution, prepare aliquots and store at -20°C. Avoid freeze/thaw cycles.
• Reconstitution: It is recommended to reconstitute the lyophilized Dog IL18 in sterile and pre-cooled ddH2O not less than 0.1mg/ml, which can then be further diluted to other aqueous solutions.

Gene Information

• Gene Name: IL18 interleukin 18 (interferon-gamma-inducing factor) [ Canis lupus familiaris ]
• Official Symbol: il18
• Synonyms: IL18; interleukin 18 (interferon-gamma-inducing factor); interleukin-18; IL-18; IL-1 gamma; interleukin-1 gamma; IFN-gamma-inducing factor; interferon gamma inducing factor; interferon gamma-inducing factor; interferon-gamma-inducing factor; IGIF
• Gene ID: 403796
• mRNA Refseq: NM_001003169
• Protein Refseq: NP_001003169
• Pathway: African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytosolic DNA-sensing pathway, organism-specific biosystem; Cytosolic DNA-sensing pathway, conserved biosystem; Influenza A, organism-specific biosystem

Q&As

What are the difference between IL18-01HG, IL18-153HG and IL18-500H. (sequence, biological activity, QC, or what do you propose to buy)

IL18-01HG: Sequence: a.a.37-193 Endotoxin: <20 EU/mg Bio-activity: >5.0 x 10^4 IU/mg QC: Activity test, SDS-PAGE, LAL, SEC-HPLC IL18-153HG: Protein length: Tyr37-Asp193 AA Sequence: YFGKLESKLS VIRNLNDQVL FIDQGNRPLF EDMTDSDCRD NAPRTIFIISMYKDSQPRGM AVTISVKCEK ISTLSCENKI ISFKEMNPPD NIKDTKSDIIFFQRSVPGHD NKMQFESSSY EGYFLACEKE RDLFKLILKK EDELGDRSIMFTVQNEDVD Bio-activity: 1.0*10^6IU Measured by its ability to induce IFN-gamma secretion by KG‐1 human acute myelogenous leukemia cells in the presence of TNF-alpha. QC: Activity test, SDS-PAGE, LAL IL18-500H Recombinant Human IL18 will be custom produced upon order. All the sequence, purity, activity, and QC procedures will be optional and decided by our customer.