Recombinant Dog Interleukin-18

Source :	E. coli
Species :	Dog
Form :	20 mM Tris-HCl, 100 mM NaCl, 1 mM DTT, 5% Trehalose, pH7.4.
Molecular Mass :	~18kDa
AA Sequence :	YFGKLEPKLSIIRNLNDQVLFVNEGNQPVFEDMPDSDCTDNAPHTIFIIYMYKDSLTRGLAVTISVKYKTMSTLS CKNKTISFQKMSPPDSINDEGNDIIFFQRSVPGHDDKIQFESSLYKGHFLACKKENDLFKLILKDKDENGDKSIM FTVQNKS
Purity :	>95% as determined by SDS-PAGE
Storage :	Short Term Storage +4°C, Long Term Storage -20°C. After reconstitution, prepare aliquots and store at -20°C. Avoid freeze/thaw cycles.
Reconstitution :	It is recommended to reconstitute the lyophilized Dog IL18 in sterile and pre-cooled ddH2O not less than 0.1mg/ml, which can then be further diluted to other aqueous solutions.
Tag :	Non

Gene Name	IL18 interleukin 18 (interferon-gamma-inducing factor) [ Canis lupus familiaris ]
Official Symbol	il18
Synonyms	IL18; interleukin 18 (interferon-gamma-inducing factor); interleukin-18; IL-18; IL-1 gamma; interleukin-1 gamma; IFN-gamma-inducing factor; interferon gamma inducing factor; interferon gamma-inducing factor; interferon-gamma-inducing factor; IGIF;
Gene ID	403796
mRNA Refseq	NM_001003169
Protein Refseq	NP_001003169
Pathway	African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytosolic DNA-sensing pathway, organism-specific biosystem; Cytosolic DNA-sensing pathway, conserved biosystem; Influenza A, organism-specific biosystem;