Active Recombinant Rat Cxcl2 Protein (69 aa)

• Cat.No.: Cxcl2-387C
• Product Overview: Recombinant Rat GRO-β/CINC-3/CXCL2 produced in E. coli is a single non-glycosylated polypeptide chain containing 69 amino acids. A fully biologically active molecule, rrGRO-β has a molecular mass of 7.6kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.

Specification

• Species: Rat
• Source: E.coli
• Protein Length: 69
• Description: Chemokine (C-X-C motif) ligand 2(CXCL2) is a small cytokine belonging to the CXC chemokine family that is also called macrophage inflammatory protein 2-alpha (MIP2-alpha), Growth-regulated protein beta (Gro-beta) and Gro oncogene-2 (Gro-2). CXCL2 shares 90% amino acid sequence with CXCL1/GROα. The GRO proteins are chemotactic for neutrophils and basophils and can activate them through their CXCR1 or CXCR2 receptors.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: The EC50 value of Rat GRO-β/CINC-3/CXCL2 on Ca^2+ mobilization assay in CHO-K1/Gα15/rCXCR2 cells (human Gα15 and rat CXCR2 stably expressed in CHO-K1 cells) is less than 10 ng/mL.
• Molecular Mass: 7.6 kDa, observed by reducing SDS-PAGE.
• AA Sequence: SELRCQCLTTLPRVDFKNIQSLTVTPPGPHCAQTEVIATLKDGHEVCLNPEAPLVQRIVQKILNKGKAN
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE.
• Storage: Lyophilized recombinant Rat GRO-β/CINC-3/CXCL2 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Rat GRO-β/CINC-3/CXCL2 should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: Cxcl2 chemokine (C-X-C motif) ligand 2 [ Rattus norvegicus ]
• Official Symbol: Cxcl2
• Synonyms: CXCL2; chemokine (C-X-C motif) ligand 2; C-X-C motif chemokine 2; MIP2; CINC-3; macrophage inflammatory protein 2; small inducible cytokine subfamily, member 2; cytokine-induced neutrophil chemoattractant 3; Mip-2; Scyb2
• Gene ID: 114105
• mRNA Refseq: NM_053647
• Protein Refseq: NP_446099
• UniProt ID: P30348