Active Recombinant Rat Csf3 Protein (194 aa)

• Cat.No.: Csf3-395C
• Product Overview: Recombinant rat Granulocyte Colony-Stimulating Factor (rrG-CSF) produced in E. coli is a single non-glycosylated polypeptide chain containing of 194 amino acids. A fully biologically active molecule, rrG-CSF has a molecular mass of 21.4 kDa analyzed by non-reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.

Specification

• Species: Rat
• Source: E.coli
• Protein Length: 194
• Description: Granulocyte Colony-Stimulating Factor (G-CSF) is a hematopoietic cytokine belonging to the four-helix bundle cytokine superfamily. G-CSF is produced by monocytes, macrophages, fibroblasts, and endothelial cells. Its expression is highly regulated and induced by a variety of agents, including Tumor Necrosis Factor (TNF), Interleukin-1 (IL-1), Interferon γ (IFN-γ), and Granulocyte-Macrophage Colony-Stimulating Factor (GM-CSF). G-CSF binds to the CSF-specific high affinity receptors expressed on neutrophilic granulocyte lineage. In vivo G-CSF regulates the production of neutrophilic granulocytes, a critical part of host defense systems, and helps the maturation of leukemic cell lines. G-CSF is widely employed clinically because of its fairly innocuous safety profile.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 0.1 ng/mL, measured by a cell proliferation assay using NSF-60 cells, corresponding to a specific activity of > 1 × 10^7 units/mg.
• Molecular Mass: 21.4 kDa, observed by non-reducing SDS-PAGE.
• AA Sequence: MIPLLTVSSLPPSLPLPRSFLLKSLEQVRKIQARNTELLEQLCATYKLCHPEELVLFGHSLGIPKASLSSCSSQALQQTKCLSQLHSGLFLYQGLLQALAGISSELAPTLDMLHLDVDNFATTIWQQMESLGVAPTVQPTQSTMPIFTSAFQRRAGGVLVTSYLQSFLETAHHALHHLPRPAQKHFPESLFISI
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% by SDS-PAGE analysis.
• Storage: Lyophilized recombinant rat Granulocyte Colony-Stimulating Factor (rrG-CSF) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rrG-CSF remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against 20mM Citric Acid
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Gene Name: Csf3 colony stimulating factor 3 (granulocyte) [ Rattus norvegicus ]
• Official Symbol: Csf3
• Synonyms: CSF3; colony stimulating factor 3 (granulocyte); granulocyte colony-stimulating factor
• Gene ID: 25610
• mRNA Refseq: NM_017104
• Protein Refseq: NP_058800