Active Recombinant Rat Csf3 Protein (194 aa)
Cat.No. : | Csf3-395C |
Product Overview : | Recombinant rat Granulocyte Colony-Stimulating Factor (rrG-CSF) produced in E. coli is a single non-glycosylated polypeptide chain containing of 194 amino acids. A fully biologically active molecule, rrG-CSF has a molecular mass of 21.4 kDa analyzed by non-reducing SDS-PAGE and is obtained by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Protein Length : | 194 |
Description : | Granulocyte Colony-Stimulating Factor (G-CSF) is a hematopoietic cytokine belonging to the four-helix bundle cytokine superfamily. G-CSF is produced by monocytes, macrophages, fibroblasts, and endothelial cells. Its expression is highly regulated and induced by a variety of agents, including Tumor Necrosis Factor (TNF), Interleukin-1 (IL-1), Interferon γ (IFN-γ), and Granulocyte-Macrophage Colony-Stimulating Factor (GM-CSF). G-CSF binds to the CSF-specific high affinity receptors expressed on neutrophilic granulocyte lineage. In vivo G-CSF regulates the production of neutrophilic granulocytes, a critical part of host defense systems, and helps the maturation of leukemic cell lines. G-CSF is widely employed clinically because of its fairly innocuous safety profile. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 0.1 ng/mL, measured by a cell proliferation assay using NSF-60 cells, corresponding to a specific activity of > 1 × 10^7 units/mg. |
Molecular Mass : | 21.4 kDa, observed by non-reducing SDS-PAGE. |
AA Sequence : | MIPLLTVSSLPPSLPLPRSFLLKSLEQVRKIQARNTELLEQLCATYKLCHPEELVLFGHSLGIPKASLSSCSSQALQQTKCLSQLHSGLFLYQGLLQALAGISSELAPTLDMLHLDVDNFATTIWQQMESLGVAPTVQPTQSTMPIFTSAFQRRAGGVLVTSYLQSFLETAHHALHHLPRPAQKHFPESLFISI |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% by SDS-PAGE analysis. |
Storage : | Lyophilized recombinant rat Granulocyte Colony-Stimulating Factor (rrG-CSF) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rrG-CSF remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against 20mM Citric Acid |
Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
Gene Name | Csf3 colony stimulating factor 3 (granulocyte) [ Rattus norvegicus ] |
Official Symbol | Csf3 |
Synonyms | CSF3; colony stimulating factor 3 (granulocyte); granulocyte colony-stimulating factor; |
Gene ID | 25610 |
mRNA Refseq | NM_017104 |
Protein Refseq | NP_058800 |
◆ Recombinant Proteins | ||
CSF3-178H | Active Recombinant Human CSF3 Protein | +Inquiry |
Csf3-100M | Recombinant Mouse Csf3 protein | +Inquiry |
CSF3-281C | Active Recombinant Human CSF3 Protein | +Inquiry |
CSF3-21H | Active Recombinant Human CSF3, His-tagged | +Inquiry |
CSF3-359R | Recombinant Rhesus macaque Macaque Colony Stimulating Factor 3 (granulocyte) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSF3-2948HCL | Recombinant Human CSF3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Csf3 Products
Required fields are marked with *
My Review for All Csf3 Products
Required fields are marked with *
0
Inquiry Basket