Active Recombinant Rat CSF1 Protein
Cat.No. : | CSF1-42R |
Product Overview : | Recombinant Rat CSF1 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Description : | Macrophage colony stimulating factor (M-CSF) is a hematopoietic growth factor that is widely produced by a variety of cells. M-CSF stimulates the proliferation and differentiation of hematopoietic stem cells into monocyte and macrophage cell types. M-CSF also acts through the colony stimulating factor 1 receptor (CSF1R) to modulate processes involved in immunology, bone metabolism, fertility, and pregnancy. |
Source : | E. coli |
Species : | Rat |
Bio-activity : | NFS-60 Proliferation, ED50≤10 ng/mL (≥1.0 x 10^5 units/mg) (typical ED50 is < 2 ng/mL) |
Molecular Mass : | Dimer, 18.1/36.2 kDa (155/210 aa) |
AA Sequence : | MEVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSLAKCSSRDVVTKP |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | Csf1 colony stimulating factor 1 (macrophage) [ Rattus norvegicus (Norway rat) ] |
Official Symbol | CSF1 |
Synonyms | CSF1; colony stimulating factor 1 (macrophage); macrophage colony-stimulating factor 1; MCSF; CSF-1; |
Gene ID | 78965 |
mRNA Refseq | NM_023981 |
Protein Refseq | NP_076471 |
UniProt ID | Q8JZQ0 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All CSF1 Products
Required fields are marked with *
My Review for All CSF1 Products
Required fields are marked with *
0
Inquiry Basket