Active Recombinant Rat CSF1 Protein

Cat.No. : CSF1-42R
Product Overview : Recombinant Rat CSF1 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Description : Macrophage colony stimulating factor (M-CSF) is a hematopoietic growth factor that is widely produced by a variety of cells. M-CSF stimulates the proliferation and differentiation of hematopoietic stem cells into monocyte and macrophage cell types. M-CSF also acts through the colony stimulating factor 1 receptor (CSF1R) to modulate processes involved in immunology, bone metabolism, fertility, and pregnancy.
Bio-activity : NFS-60 Proliferation, ED50≤10 ng/mL (≥1.0 x 10^5 units/mg)
(typical ED50 is < 2 ng/mL)
Molecular Mass : Dimer, 18.1/36.2 kDa (155/210 aa)
AA Sequence : MEVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSLAKCSSRDVVTKP
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name Csf1 colony stimulating factor 1 (macrophage) [ Rattus norvegicus (Norway rat) ]
Official Symbol CSF1
Synonyms CSF1; colony stimulating factor 1 (macrophage); macrophage colony-stimulating factor 1; MCSF; CSF-1;
Gene ID 78965
mRNA Refseq NM_023981
Protein Refseq NP_076471
UniProt ID Q8JZQ0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CSF1 Products

Required fields are marked with *

My Review for All CSF1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon