Active Recombinant Human CSF1 Protein (1-149 aa)
Cat.No. : | CSF1-083C |
Product Overview : | Recombinant Human CSF1 Protein without tag was expressed in Baculovirus infected Silkworm. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Silkworm |
Protein Length : | 1-149 |
Description : | M-CSF, also known as CSF-1, is a four α helical bundle cytokine that is the primary regulator of macrophage survival, proliferation and differentiation. M-CSF is also essential for the survival and proliferation of osteoclast progenitors. M-CSF also primes and enhances macrophage killing of tumor cells and microorganisms, regulates the release of cytokines and other inflammatory modulators from macrophages, and stimulates pinocytosis. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant stimulation of the proliferation of murine M-NSF-60 cells is less than 3.0 ng/mL, corresponding to a Specific Activity of >3.3 × 10^5 IU/mg. |
Molecular Mass : | Approximately 42.0 kDa, a covalently linked homodimer, of two 21.0 kDa polypeptide monomers (1-149 amino acid of human M-CSF). |
AA Sequence : | EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQ |
Endotoxin : | Less than 1 EU/mg of rHuM-CSF as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2mm filtered solution in 20mM PB, containing 1% HSA and 3% Mannitol. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water to a concentration of 0.1 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | CSF1 colony stimulating factor 1 (macrophage) [ Homo sapiens ] |
Official Symbol | CSF1 |
Synonyms | CSF1; colony stimulating factor 1 (macrophage); macrophage colony-stimulating factor 1; M CSF; MCSF; MGC31930; lanimostim; CSF-1; |
Gene ID | 1435 |
mRNA Refseq | NM_000757 |
Protein Refseq | NP_000748 |
MIM | 120420 |
UniProt ID | P09603 |
◆ Recombinant Proteins | ||
CSF1-4027H | Recombinant Human CSF1 Protein (Glu33-Arg255), C-His tagged | +Inquiry |
CSF1-223C | Active Recombinant Human CSF1 Protein | +Inquiry |
CSF1-5383H | Recombinant Human Colony Stimulating Factor 1 (macrophage) | +Inquiry |
CSF1-3337H | Recombinant Human CSF1 Protein, MYC/DDK-tagged | +Inquiry |
CSF1-289H | Recombinant Human CSF1 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSF1-1934HCL | Recombinant Human CSF1 cell lysate | +Inquiry |
CSF1-001MCL | Recombinant Mouse CSF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CSF1 Products
Required fields are marked with *
My Review for All CSF1 Products
Required fields are marked with *
0
Inquiry Basket