Active Recombinant Human CSF1 Protein (1-149 aa)

• Cat.No.: CSF1-083C
• Product Overview: Recombinant Human CSF1 Protein without tag was expressed in Baculovirus infected Silkworm.

Specification

• Description: M-CSF, also known as CSF-1, is a four α helical bundle cytokine that is the primary regulator of macrophage survival, proliferation and differentiation. M-CSF is also essential for the survival and proliferation of osteoclast progenitors. M-CSF also primes and enhances macrophage killing of tumor cells and microorganisms, regulates the release of cytokines and other inflammatory modulators from macrophages, and stimulates pinocytosis.
• Source: Baculovirus infected Silkworm
• Species: Human
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant stimulation of the proliferation of murine M-NSF-60 cells is less than 3.0 ng/mL, corresponding to a Specific Activity of ＞3.3 × 10^5 IU/mg.
• Molecular Mass: Approximately 42.0 kDa, a covalently linked homodimer, of two 21.0 kDa polypeptide monomers (1-149 amino acid of human M-CSF).
• Protein length: 1-149
• AA Sequence: EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQ
• Endotoxin: Less than 1 EU/mg of rHuM-CSF as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
• Storage Buffer: Lyophilized from a 0.2mm filtered solution in 20mM PB, containing 1% HSA and 3% Mannitol.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water to a concentration of 0.1 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: CSF1 colony stimulating factor 1 (macrophage) [ Homo sapiens ]
• Official Symbol: CSF1
• Synonyms: CSF1; colony stimulating factor 1 (macrophage); macrophage colony-stimulating factor 1; M CSF; MCSF; MGC31930; lanimostim; CSF-1
• Gene ID: 1435
• mRNA Refseq: NM_000757
• Protein Refseq: NP_000748
• MIM: 120420
• UniProt ID: P09603