Active Recombinant Rat Cntf Protein (199 aa)

• Cat.No.: Cntf-433C
• Product Overview: Recombinant Rat Ciliary Neurotrophic Factor (CNTF) produced in E. coli is a single, non-glycosylated polypeptide chain of 199 amino acids and a molecular mass of 22.9 kDa. It has been purified by chromatographic techniques.

Specification

• Species: Rat
• Source: E.coli
• Protein Length: 199
• Description: Ciliary Neurotrophic Factor (CNTF) is a polypeptide hormone which acts within the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. CNTF is a potent survival factor for neurons and oligodendrocytes and may play a role in reducing tissue damage during increased inflammation. A mutation in this gene, which results in aberrant splicing, leads to ciliary neurotrophic factor deficiency, however this phenotype is not causally related to neurologic disease.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 30 ng/mL, measured by its ability to induce alkaline phosphatase production byTF-1 Cells.
• Molecular Mass: 22.9 kDa, observed by reducing SDS-PAGE
• AA Sequence: AFAEQTPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE.
• Storage: Lyophilized recombinant Rat CNTF remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rrCNTF should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against 50mM Tris, pH 8.0.
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Gene Name: Cntf ciliary neurotrophic factor [ Rattus norvegicus ]
• Official Symbol: Cntf
• Synonyms: CNTF; ciliary neurotrophic factor; ciliary neurotropic factor
• Gene ID: 25707
• mRNA Refseq: NM_013166
• Protein Refseq: NP_037298
• UniProt ID: P20294