Active Recombinant Rabbit GHR Protein

Cat.No. : GHR-1836R
Product Overview : Recombinant Rabbit GHR extracellular portion was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rabbit
Source : E.coli
Tag : Non
Form : Lyophilized from a concentrated (1mg/ml) solution with 0.0045 mM NaHCO3.
Bio-activity : Evidenced by its ability of forming 2:1 complex with non-primate Growth Hormones.
Molecular Mass : 28 kDa
AA Sequence : AFSGSEATPATLGRASESVQRVHPGLGTNSSGKPKFTKCRSPELETFSCHWTDGVHHGLKSPGSVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTNNGGMVDQKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRSSEKYGEFSEVLYVTLPQMSPFTCEEDFRFP
Purity : > 98.0% as determined by SDS-PAGE
Storage : Lyophilized Growth Hormone Binding Protein Rabbit although stable at room temperature for 3 weeks, should be stored desiccated below -18 centigrade. Upon reconstitution GHBP Rabbit should be stored at 4 centigrade between 2-7 days and for future use below
Reconstitution : It is recommended to reconstitute the lyophilized GHBP Rabbit in sterile 0.4% NaHCO3 pH 10, not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Gene Name GHR growth hormone receptor [ Oryctolagus cuniculus ]
Official Symbol GHR
Synonyms GHR; growth hormone receptor; GH receptor; somatotropin receptor
Gene ID 100009325
mRNA Refseq NM_001082636
Protein Refseq NP_001076105
UniProt ID P19941

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GHR Products

Required fields are marked with *

My Review for All GHR Products

Required fields are marked with *

0

Inquiry Basket

cartIcon