Active Recombinant Mouse Vegfa, Isoform 164, His-tagged

• Cat.No.: Vegfa-728M
• Product Overview: Mouse VEGF164, also known as VEGF, is expressed as a 175-amino acid protein consisting of the region Ala27 - Arg190 of mouse VEGF (UniProt Accession #Q00731-2, isoform VEGF164) and a C-terminal His-tag. It contains 1 potential sites for N-linked glycosylation and exists as a dimer under non-reducing condition.

Specification

• Source: Human cells
• Species: Mouse
• Tag: His
• Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
• Bio-activity: Binds its receptors (FLT1, KDR) and anti-VEGF monoclonal antobodies with high affinity (KD< 10 nM as measured by ELISA). Stimulates HUVEC (human umbilical vein endothelial cells) proliferation and certain tumor cell growth.
• Molecular Mass: Calculated molecular mass (kDa): 20.6; Estimated by SDS-PAGE under reducing condition (kDa): ~30 (probably due to glycosylation)
• AA Sequence: APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESN ITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKAR QLELNERTCRCDKPRRSTGHHHHHHHH
• Endotoxin: <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">
• Purity: >95% judged by SDS-PAGE under reducing condition
• Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
• Protein length: 27-190 a.a.

Gene Information

• Gene Name: Vegfa vascular endothelial growth factor A [ Mus musculus ]
• Official Symbol: Vegfa
• Synonyms: VEGFA; vascular endothelial growth factor A; vascular permeability factor; Vpf; Vegf; Vegf120; Vegf164; Vegf188
• Gene ID: 22339
• mRNA Refseq: NM_001025250
• Protein Refseq: NP_001020421
• Pathway: Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Endochondral Ossification, organism-specific biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem
• Function: cell surface binding; chemoattractant activity; cytokine activity; fibronectin binding; growth factor activity; heparin binding; platelet-derived growth factor receptor binding; protein heterodimerization activity; protein homodimerization activity; receptor agonist activity; vascular endothelial growth factor receptor 1 binding; vascular endothelial growth factor receptor 2 binding; vascular endothelial growth factor receptor binding