Active Recombinant Mouse VEGF165 Protein (165 aa)
Cat.No. : | Vegfa-014V |
Product Overview : | Recombinant Mouse VEGF165 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Description : | VEGF was initially purified from media conditioned by normal bovine pituitary folliculo-stellate cells and by a variety of transformed cell lines as a mitogen specific for vascular endothelial cells. It was subsequently found to be identical to an independently discovered vascular permeability factor (VPF), which was previously identified in media conditioned by tumor cell lines based on its ability to increase the permeability of capillary blood vessels. Three mouse cDNA clones, which arise through alternative splicing and which encode mature mouse monomeric VEGF having 120, 164, or 188, amino acids, respectively, have been identified. Two receptor tyrosine kinases (RTKs), Flt-1 and Flk-1 (the mouse homologue of human KDR), both members of the type III subclass of RTKs containing seven immunoglobulin-like repeats in their extracellular domains, have been shown to bind VEGF with high affinity. The roles of the homodimers of KDR, Flt, and the heterodimer ofKDR/Flt in VEGF signal transduction remain to be elucidated.In vivo, VEGF has been found to be a potent angiogenesis inducer. |
Source : | E. coli |
Species : | Mouse |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Measured by its ability to stimulate 3H-thymidine incorporation in HUVE cells. The ED50 for this effect is typically 2 - 4 ng/mL, corresponding to a Specific Activity of >2.5 × 10^5 IU/mg. |
Molecular Mass : | Recombinant murine VEGF165 is a 39.0 kDa disulfide-linked homodimeric protein consisting of two 165 amino acid polypeptide chains. |
Protein length : | 165 |
AA Sequence : | MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
Endotoxin : | Less than 1 EU/mg of rmVEGF165 as determined by LAL method |
Purity : | >95% by SDS-PAGE and HPLC analyses |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2mm filtered solution in PBS, pH 7.4. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Vegfa vascular endothelial growth factor A [ Mus musculus ] |
Official Symbol | Vegfa |
Synonyms | VEGFA; vascular endothelial growth factor A; vascular permeability factor; Vpf; Vegf; Vegf120; Vegf164; Vegf188; |
Gene ID | 22339 |
mRNA Refseq | NM_001025250 |
Protein Refseq | NP_001020421 |
UniProt ID | Q00731 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Vegfa Products
Required fields are marked with *
My Review for All Vegfa Products
Required fields are marked with *
0
Inquiry Basket