Recombinant Mouse VEGFA protein
Cat.No. : | VEGFA-47M |
Product Overview : | Recombinant Mouse VEGFA protein(121 a.a.) was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Description : | Vascular Endothelial Growth Factor is a sub-family of growth factors produced by cells that stimulates vasculogenesis and angiogenesis. VEGF's normal function is to create new blood vessels during embryonic development, new blood vessels after injury, muscle following exercise, and new vessels (collateral circulation) to bypass blocked vessels. VEGF signals through the three receptors: fms-like tyrosine kinase (flt-1), KDR gene product (the murine homolog of KDR is the flk-1 gene product) and the flt4 gene product. Mouse express alternately spliced isoforms of 120, 164, 182 amino acids (a.a.) in length. The VEGF120 shares 98 % a.a. sequence identity with corresponding regions of rat, 89 % with canine, feline, equine and porcine, and 87 % with human, ovine and bovine VEGF, respectively. |
Source : | E.coli |
Species : | Mouse |
Form : | Lyophilized from a 0.2μm filtered solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human umbilical vein endothelial cells(HUVEC) is less than 5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁵ IU/mg. |
Molecular Mass : | Approximately 28.4 kDa, a disulfide-linked homodimeric protein consisting of two 121 amino acid polypeptide chains with Met at N-terminus. |
Protein length : | 121 |
AA Sequence : | MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR |
Endotoxin : | Less than 1 EU/μg of rMuVEGF120 as determined by LAL method. |
Purity : | >96% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Tag : | Non |
Gene Name | VEGFA |
Official Symbol | VEGFA |
Synonyms | VEGFA; vascular endothelial growth factor A; vascular permeability factor; Vpf; Vegf; Vegf120; Vegf164; Vegf188; |
Gene ID | 22339 |
mRNA Refseq | NM_001025250 |
Protein Refseq | NP_001020421 |
UniProt ID | Q00731 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All VEGFA Products
Required fields are marked with *
My Review for All VEGFA Products
Required fields are marked with *
0
Inquiry Basket