Active Recombinant Mouse Shh Protein

• Cat.No.: Shh-5862M
• Product Overview: Purified recombinant protein of Mouse sonic hedgehog (Shh) without tag was expressed in E. coli.

Specification

• Description: The C-terminal part of the sonic hedgehog protein precursor displays an autoproteolysis and a cholesterol transferase activity. Both activities result in the cleavage of the full-length protein into two parts (ShhN and ShhC) followed by the covalent attachment of a cholesterol moiety to the C-terminal of the newly generated ShhN. Both activities occur in the reticulum endoplasmic. Once cleaved, ShhC is degraded in the endoplasmic reticulum.
• Source: E. coli
• Species: Mouse
• Bio-activity: Determined by its ability to induce alkaline phosphatase production by C3H/10T1/2 (CCL-226) cells. The expected ED50 for this effect is 0.5-1.0μg/mL.
• Molecular Mass: 20 kDa
• AA Sequence: IVIGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG
• Endotoxin: < 0.1 ng/μg of protein (< 1 EU/μg)
• Purity: > 90% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Unopened vial can be stored between 2 and 8 centigrade for up to 2 weeks, at -20 centigrade for up to 6 months, or at -70 centigrade or below until the expiration date. Aliquots can be stored between 2 and 8 centigrade for up to one week and stored at -20 centigrade or colder for up to 3 months. Avoid repeated freeze/thaw cycles.
• Storage: Store at -80 centigrade.
• Storage Buffer: LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2

Gene Information

• Gene Name: Shh sonic hedgehog [ Mus musculus (house mouse) ]
• Official Symbol: Shh
• Synonyms: SHH; sonic hedgehog; sonic hedgehog protein; HHG-1; short digits; hemimelic extra toes; Hx; Dsh; Hhg1; Hxl3; M100081; 9530036O11Rik
• Gene ID: 20423
• mRNA Refseq: NM_009170
• Protein Refseq: NP_033196
• UniProt ID: Q62226