Species : |
Mouse |
Source : |
E.coli |
Protein Length : |
176 |
Description : |
Sonic Hedgehog (Shh) is a member of the Hedgehog (Hh) family of highly conserved proteins which are widely represented throughout the animal kingdom. In mammal, there are threerelatedHh proteins, Sonic (Shh), Desert (Dhh) and Indian (Ihh). They share a high degree of amino-acid sequence identity (e.g., Shh and Ihh are 93% identical). Sonic Hedgehog plays a role in cell growth, cell specialization, and the normal shaping (patterning) of the body. Shh is also important for development of the brain and spinal cord (central nervous system), eyes, limbs, and many other parts of the body. |
Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : |
ED50< 1.0 μg/mL, measured by its ability to induce alkaline phosphatase production by C3H/10T1/2 (CCL-226) Cells, corresponding to a specific activity of>1.0 × 10^3units/mg. |
Molecular Mass : |
19.8kDa, observed by reducing SDS-PAGE. |
AA Sequence : |
IVIGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG |
Endotoxin : |
< 0.2 EU/μg, determined by LAL method. |
Purity : |
> 95% by SDS-PAGE and HPLC analyses. |
Storage : |
Lyophilized recombinant mouseSonic Hedgehog(rmShh)remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmShhshould be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : |
Lyophilized after extensive dialysis against PBS. |
Reconstitution : |
Reconstituted in ddH2O at 100 μg/mL. |