Active Recombinant Mouse Platelet receptor Gi24, His-tagged

• Cat.No.: Gi24-717M
• Product Overview: The recombinant mouse B7-H5 protein is expressed as a 173 amino acid protein consisting of Phe33 - Ala191 region of B7-H5 (UniProt accession #Q9D659) and and a C-terminal His-tag. It contains 3 potential sites for N-linked glycosylation.

Specification

• Species: Mouse
• Source: Human Cells
• Tag: His
• Protein Length: 33-191 a.a.
• Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free).
• Bio-activity: Inhibits anti-CD3e antibody induced IL-2 secretion and T cell proliferation.
• Molecular Mass: Calculated molecular mass 19.5 kDa; estimated by SDS-PAGE under reducing condition 40-45 kDa probably due to glycosylation
• AA Sequence: FKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAA NTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVY PSSSQDSENITAASTGHHHHHHHH
• Endotoxin: <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">
• Purity: >95% judged by SDS-PAGE under reducing condition.
• Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.