Active Recombinant Mouse OX40L Protein, His-Tagged

• Cat.No.: OX40L-01M
• Product Overview: Recombinant mouse OX40L Protein, His-tagged was expressed in E. coli cell

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Description: OX40L, a member of the TNF superfamily of structurally related proteins, exists primarily as a type II membrane bound, non-covalently linked homotrimeric protein. The OX40L is stably expressed on many antigen-presenting cells, such as activated B cells, mature dendritic cells, Langerhans cells, and macrophages. Interactions between OX40 and OX40L can regulate the division and survival of T cells. Its inhibition effect can make the effector T cells conversing into regulatory T cells (Tregs) and promote the recall response in memory T cells.
• Form: Lyophilized powder
• AA Sequence: QLSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVV
  ASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL with polyhistidine tag at the N-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Bio-activity: Measure by its ability to induce IL-2 secretion in mouse T cells in the presence of the anti-CD3 antibody. The ED50 for this effect is <25 ng/mL.
• Purity: >95% as determined by SDS-PAGE. Ni-NTA chromatography
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Notes: Please use within one month after protein reconstitution.