Active Recombinant Mouse LIF Protein

• Cat.No.: LIF-207M
• Product Overview: Recombinant Mouse LIF Protein without tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Leukemia inhibitory factor (LIF) is a member of the interleukin 6 (IL-6) family that is made by a variety of adult and embryonic tissues. LIF signals through the glycoprotein 130 (gp130)/LIF receptor (LIFR) heterodimer to activate STAT3 and MAPK signaling. LIF functions during hematopoietic differentiation, neuronal cell differentiation, kidney development, and inflammatory processes. Mouse LIF promotes mouse embryonic stem (ES) cell self-renewal and pluripotency in long-term cell culture systems, similar to the functional activity of FGF-basic in human ES cell culture systems.
• Bio-activity: IL-6 production by M1 cells, ≤1 ng/mL
• Molecular Mass: Monomer, 20 kDa (181 aa)
• AA Sequence: MSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF
• Endotoxin: ≤1 EUs/μg, Kinetic LAL
• Purity: ≥95%, Reducing and Non-Reducing SDS PAGE
• Stability: 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
  1 month when stored at 4 centigrade after reconstituting as directed.
  3 months when stored at -20 to -80 centigrade after reconstituting as directed.
• Storage: Storage Prior to Reconstitution: -20 centigrade
• Storage Buffer: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
• Reconstitution: Sterile 10 mM acetic acid at 0.1 mg/mL
• Shipping: Room temperature
• Instructions: Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.

Gene Information

• Gene Name: Lif leukemia inhibitory factor [ Mus musculus (house mouse) ]
• Official Symbol: LIF
• Synonyms: LIF; leukemia inhibitory factor; d factor; differentiation-stimulating factor
• Gene ID: 16878
• mRNA Refseq: NM_001039537
• Protein Refseq: NP_001034626
• UniProt ID: P09056