Active Recombinant Mouse Il5 Protein, His-tagged

Cat.No. : Il5-07M
Product Overview : Recombinant mouse IL-5 (21-133aa), fused to His-tag at C-terminus, was expressed in HEK293 and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Tag : His
Protein Length : 21-133aa
Description : Factor that induces terminal differentiation of late-developing B-cells to immunoglobulin secreting cells.
Form : Liquid
Bio-activity : Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 range ≤ 3 ng/mL.
Molecular Mass : 14.2kDa (122aa)
AA Sequence : MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE, Bioactivity
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.25 mg/mL (determined by Absorbance at 280nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name Il5 interleukin 5 [ Mus musculus (house mouse) ]
Official Symbol Il5
Synonyms Il5; interleukin 5; Il; Il-5; interleukin-5; B-cell growth factor II; BCGF-II; T-cell replacing factor; TRF; cytotoxic T-lymphocyte inducer; eosinophil differentiation factor
Gene ID 16191
mRNA Refseq NM_010558
Protein Refseq NP_034688
UniProt ID P04401

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Il5 Products

Required fields are marked with *

My Review for All Il5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon