Active Recombinant Mouse Il5 Protein, His-tagged

• Cat.No.: Il5-07M
• Product Overview: Recombinant mouse IL-5 (21-133aa), fused to His-tag at C-terminus, was expressed in HEK293 and purified by using conventional chromatography techniques.

Specification

• Species: Mouse
• Source: HEK293
• Tag: His
• Protein Length: 21-133aa
• Description: Factor that induces terminal differentiation of late-developing B-cells to immunoglobulin secreting cells.
• Form: Liquid
• Bio-activity: Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 range ≤ 3 ng/mL.
• Molecular Mass: 14.2kDa (122aa)
• AA Sequence: MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 90% by SDS-PAGE
• Applications: SDS-PAGE, Bioactivity
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.25 mg/mL (determined by Absorbance at 280nm)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol

Gene Information

• Gene Name: Il5 interleukin 5 [ Mus musculus (house mouse) ]
• Official Symbol: Il5
• Synonyms: Il5; interleukin 5; Il; Il-5; interleukin-5; B-cell growth factor II; BCGF-II; T-cell replacing factor; TRF; cytotoxic T-lymphocyte inducer; eosinophil differentiation factor
• Gene ID: 16191
• mRNA Refseq: NM_010558
• Protein Refseq: NP_034688
• UniProt ID: P04401