Active Recombinant Mouse Il5 Protein

• Cat.No.: Il5-112M
• Product Overview: Purified recombinant protein of Mouse interleukin 5 (Il5) without tag was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Factor that induces terminal differentiation of late-developing B-cells to immunoglobulin secreting cells.
• Bio-activity: ED50 was determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is > 2.0 ng/ml, corresponding to a specific activity of > 5 x 10^5units/mg.
• Molecular Mass: 26.2 kDa
• AA Sequence: MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Reconstitution: Resuspend the protein in the desired concentration in proper buffer.

Gene Information

• Gene Name: Il5 interleukin 5 [ Mus musculus (house mouse) ]
• Official Symbol: Il5
• Synonyms: Il5; interleukin 5; Il-5; interleukin-5; B-cell growth factor II; BCGF-II; T-cell replacing factor; TRF; cytotoxic T-lymphocyte inducer; eosinophil differentiation factor
• Gene ID: 16191
• mRNA Refseq: NM_010558
• Protein Refseq: NP_034688
• UniProt ID: P04401