Active Recombinant Mouse Il5 Protein (113 aa)
Cat.No. : | Il5-353I |
Product Overview : | Recombinant mouse Interleukin-5 (rmIL-5) produced in E. coli is a disulfide-linked homodimer containing two non-glycosylated polypeptide chains of 113 amino acids each. A fully biologically active molecule, rmIL-5 has a molecular mass of 26.2kDa analyzed by non-reducing SDS-PAGE and is obtained by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Protein Length : | 113 |
Description : | Interleukin-5 (IL-5),produced by mast cells, T cells and eosinophils, is responsible for the activities attributed to eosinophil differentiating factor, B cell growth factor II and T cell-replacing factor (TRF). It can increase production and mobilization of eosinophils and CD34+ progenitors from the bone marrow. IL-5 plays an important role in inducing cell-mediated immunity against parasitic infections and certain tumors. IL-5 also promotes differentiation of basophils and primes them for histamine and leukotriene release. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 2.0 ng/mL, measured by a cell proliferation assay using TF-1 Cells, corresponding to a specific activity of > 5.0 × 10^5 units/mg. |
Molecular Mass : | 26.2kDa, observed by non-reducing SDS-PAGE. |
AA Sequence : | MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% by SDS-PAGE and HPLC analyses. |
Storage : | Lyophilized recombinant mouse Interleukin-5 (rmIL-5) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmIL-5 should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
Gene Name | Il5 interleukin 5 [ Mus musculus ] |
Official Symbol | Il5 |
Synonyms | IL5; interleukin 5; interleukin-5; TRF; BCGF-II; B-cell growth factor II; T-cell replacing factor; cytotoxic T-lymphocyte inducer; eosinophil differentiation factor; Il-5; |
Gene ID | 16191 |
mRNA Refseq | NM_010558 |
Protein Refseq | NP_034688 |
UniProt ID | P04401 |
◆ Recombinant Proteins | ||
IL5-27C | Recombinant Canine IL-5 | +Inquiry |
IL5-312H | Active Recombinant Human IL5 protein(Ile20-Ser134) | +Inquiry |
IL5-2177C | Active Recombinant Canine IL5 Protein, His-tagged | +Inquiry |
IL5-653R | Recombinant Rhesus monkey IL5 protein, His & GST-tagged | +Inquiry |
IL5-051HB | Recombinant Human IL5 protein, His-Avi-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL5-456CCL | Recombinant Canine IL5 cell lysate | +Inquiry |
IL5-496MCL | Recombinant Mouse IL5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il5 Products
Required fields are marked with *
My Review for All Il5 Products
Required fields are marked with *
0
Inquiry Basket