Active Recombinant Mouse Il5 Protein (113 aa)

• Cat.No.: Il5-353I
• Product Overview: Recombinant mouse Interleukin-5 (rmIL-5) produced in E. coli is a disulfide-linked homodimer containing two non-glycosylated polypeptide chains of 113 amino acids each. A fully biologically active molecule, rmIL-5 has a molecular mass of 26.2kDa analyzed by non-reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.

Specification

• Species: Mouse
• Source: E.coli
• Protein Length: 113
• Description: Interleukin-5 (IL-5),produced by mast cells, T cells and eosinophils, is responsible for the activities attributed to eosinophil differentiating factor, B cell growth factor II and T cell-replacing factor (TRF). It can increase production and mobilization of eosinophils and CD34+ progenitors from the bone marrow. IL-5 plays an important role in inducing cell-mediated immunity against parasitic infections and certain tumors. IL-5 also promotes differentiation of basophils and primes them for histamine and leukotriene release.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 2.0 ng/mL, measured by a cell proliferation assay using TF-1 Cells, corresponding to a specific activity of > 5.0 × 10^5 units/mg.
• Molecular Mass: 26.2kDa, observed by non-reducing SDS-PAGE.
• AA Sequence: MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% by SDS-PAGE and HPLC analyses.
• Storage: Lyophilized recombinant mouse Interleukin-5 (rmIL-5) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmIL-5 should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Gene Name: Il5 interleukin 5 [ Mus musculus ]
• Official Symbol: Il5
• Synonyms: IL5; interleukin 5; interleukin-5; TRF; BCGF-II; B-cell growth factor II; T-cell replacing factor; cytotoxic T-lymphocyte inducer; eosinophil differentiation factor; Il-5
• Gene ID: 16191
• mRNA Refseq: NM_010558
• Protein Refseq: NP_034688
• UniProt ID: P04401