Active Recombinant Mouse Il4 Protein, His-Tagged
Cat.No. : | Il4-01M |
Product Overview : | Recombinant mouse Il4 Protein, His-tagged was expressed in E. coli cell |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | The interleukin 4 (IL4, IL-4) is a cytokine that induces differentiation of naive helper T cells (Th0 cells) to Th2 cells. Upon activation by IL-4, Th2 cells subsequently produce additional IL-4 in a positive feedback loop. The cell that initially produces IL-4, thus inducing Th2 differentiation, has not been identified, but recent studies suggest that basophils may be the effector cell. It is closely related and has functions similar to Interleukin 13. |
Form : | Lyophilized powder |
AA Sequence : | MHIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISC TMNESKSTSLKDFLESLKSIMQMDYS with polyhistidine tag at the C-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Bio-activity : | Measure by its ability to induce HT-2 cells proliferation. The ED50 for this effect is <1 ng/mL. The specific activity of recombinant mouse IL-4 is approximately >1 x 10^6 IU/mg. |
Purity : | ≥98% as determined by SDS-PAGE and HPLC. Purified by Ni-NTA chromatography. |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Notes : | Please use within one month after protein reconstitution. |
Gene Name | Il4 interleukin 4 [ Mus musculus (house mouse) ] |
Official Symbol | Il4 |
Synonyms | Il-4; BSF-1 |
Gene ID | 16189 |
mRNA Refseq | NM_021283.2 |
Protein Refseq | NP_067258.1 |
UniProt ID | P07750 |
◆ Recombinant Proteins | ||
IL4-1801HFL | Recombinant Full Length Human IL4 Protein, C-Flag-tagged | +Inquiry |
IL4-669E | Active Recombinant Equine IL4 | +Inquiry |
IL4-9291P | Active Recombinant Porcine IL4 | +Inquiry |
Il4-109M | Active Recombinant Mouse Il4 Protein | +Inquiry |
IL4-205P | Recombinant Active Pig IL4 Protein, His-tagged(C-ter) | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL4-001MCL | Recombinant Mouse IL4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il4 Products
Required fields are marked with *
My Review for All Il4 Products
Required fields are marked with *
0
Inquiry Basket