Active Recombinant Mouse IL4 Protein
Cat.No. : | IL4-179M |
Product Overview : | Recombinant Mouse IL4 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Interleukin 4 (IL-4) is an immunomodulatory cytokine that functions to induce naïve helper T cells to differentiate into type 2 T helper (Th2) cells. Th2 cells subsequently produce more IL-4 in a positive feedback loop. IL-4 also promotes immunoglobulin IgG to IgE isotype switching on B cells. IL-4 binds the IL-4Rα receptor to activate STAT6 signaling. |
Bio-activity : | HT-2 proliferation, ≤20 ng/mL; ≥5.0 x 10^4 units/mg |
Molecular Mass : | Monomer, 13.7 kDa (121 aa) |
AA Sequence : | MHIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | Il4 interleukin 4 [ Mus musculus (house mouse) ] |
Official Symbol | IL4 |
Synonyms | IL4; interleukin 4; interleukin-4; IGG1 induction factor; B-cell growth factor 1; B-cell stimulatory factor 1; lymphocyte stimulatory factor 1; B-cell IgG differentiation factor; Il-4; BSF-1; |
Gene ID | 16189 |
mRNA Refseq | NM_021283 |
Protein Refseq | NP_067258 |
UniProt ID | P07750 |
◆ Recombinant Proteins | ||
IL4-094I | Active Recombinant Human IL4 Protein (130 aa) | +Inquiry |
IL4-363H | Active Recombinant Human il4, MIgG2a Fc-tagged, mutant | +Inquiry |
IL4-017H | Recombinant Hamster IL4 Protein, Met1-Phe147, C-His tagged | +Inquiry |
IL4-3105H | Recombinant Human IL4 protein, His-SUMO-tagged | +Inquiry |
IL4-5449S | Recombinant Sheep IL4 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL4-001MCL | Recombinant Mouse IL4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL4 Products
Required fields are marked with *
My Review for All IL4 Products
Required fields are marked with *
0
Inquiry Basket