Active Recombinant Mouse Il27 Protein
Cat.No. : | Il27-5204M |
Product Overview : | Mouse Il27 (Q8K3I6) recombinant protein expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Description : | Interleukin 27 (IL-27) is a member of the IL-12 cytokine family. It is a heterodimeric cytokine that is composed of two distinct genes, Epstein-Barr virus-induced gene 3 (EBI3) and IL-27p28. IL-27 is expressed by antigen presenting cells and interacts with a specific cell-surface receptor complex known as IL-27 receptor (IL-27R). This receptor consists of two proteins, IL-27ɑ and gp130. IL-27 induces differentiation of the diverse populations of T cells in the immune system and also upregulates IL-10. |
Form : | Lyophilized |
Bio-activity : | The activity is determined by the dose-dependent inhibition of IL-17A expression from mouse CD4+ splenocytes stimulated with TGF-beta and IL-6. 50 ng/mL of mouse p28 inhibits greater than 25% of IL-17A expression. |
Molecular Mass : | 23.7 kDa |
AA Sequence : | MALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKP |
Endotoxin : | < 0.1 EU/μg |
Applications : | Functional Study SDS-PAGE |
Storage : | Store at -20 centigrade on dry atmosphere. After reconstitution with sterilized water, store at -20 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | Lyophilized with Na2PO4, pH 7.5. |
Gene Name | Il27 interleukin 27 [ Mus musculus ] |
Official Symbol | Il27 |
Synonyms | IL27; interleukin 27; interleukin-27 subunit alpha; IL27-A; IL-27-A; interleukin 30; IL-27 p28 subunit; IL-27 subunit alpha; p28; Il30; IL-27; IL-27p28; |
Gene ID | 246779 |
mRNA Refseq | NM_145636 |
Protein Refseq | NP_663611 |
◆ Recombinant Proteins | ||
Il27-506M | Active Recombinant Mouse Interleukin 27 | +Inquiry |
Il27-554M | Recombinant Mouse Il27 Protein, His-tagged | +Inquiry |
Il27-3518M | Active Recombinant Mouse Il27 Protein | +Inquiry |
IL27-311H | Recombinant Human IL27, His tagged | +Inquiry |
IL27-3777H | Recombinant Human IL27 Protein (Phe29-Pro243, Met1-Lys229), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL27-001HCL | Recombinant Human IL27 cell lysate | +Inquiry |
IL27-1309MCL | Recombinant Mouse IL27 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il27 Products
Required fields are marked with *
My Review for All Il27 Products
Required fields are marked with *
0
Inquiry Basket