Active Recombinant Mouse Il25 Protein, His-Tagged

• Cat.No.: Il25-01M
• Product Overview: Recombinant mouse Il25 Protein, His-tagged was expressed in E. coli cell

Specification

• Description: Interleukin-25 (IL-25) is a cytokine that shares sequence similarity with interleukin 17. This cytokine can induce NF-kappaB activation, and stimulate the production of interleukin 8. Both this cytokine and interleukin 17B are ligands for the cytokine receptor IL17BR. IL-25 is a member of the IL-17 family of cytokines. However, unlike the other members of this family, IL-25 promotes T helper (Th) 2 responses. IL-25 also regulates the development of autoimmune inflammation mediated by IL-17–producing T cells. IL-25 and IL-17, being members of the same cytokine family, play opposing roles in the pathogenesis of organ-specific autoimmunity.
• Source: Escherichia coli
• Species: Mouse
• Tag: His
• Form: Lyophilized powder
• AA Sequence: MVSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHC
  VSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA with polyhistidine tag at the C-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Bio-activity: Measured by its ability to induce CXCL1 secretion in HT‑29 cells. The ED50 for this effect is <1 ng/mL.
• Purity: >98% as determined by SDS-PAGE. Ni-NTA chromatography
• Storage Buffer: The protein was lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 4.5.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Notes: Please use within one month after protein reconstitution.

Gene Information

• Gene Name: Il25 interleukin 25 [ Mus musculus (house mouse) ]
• Official Symbol: Il25
• Synonyms: Il17e; IL-17e
• Gene ID: 140806
• mRNA Refseq: NM_080729.3
• Protein Refseq: NP_542767.1
• UniProt ID: Q8VHH8