Active Recombinant Mouse Il21 Protein, His-Tagged
Cat.No. : | Il21-01M |
Product Overview : | Recombinant mouse Il21 Protein, His-tagged was expressed in E. coli cell |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | Interleukin-21 (IL21) belongs to the IL-15/IL-21 family. It is a cytokine with immunoregulatory activity. Cytokines are proteinaceous signaling compounds that are major mediators of the immune response. They control many different cellular functions including proliferation, differentiation and cell survival/apoptosis but are also involved in several pathophysiological processes including viral infections and autoimmune diseases. Interleukin-21 is a cytokine that has potent regulatory effects on cells of the immune system, including natural killer (NK) cells and cytotoxic T cells that can destroy virally infected or cancerous cells. This cytokine induces cell division/proliferation in its target cells. |
Form : | Lyophilized powder |
AA Sequence : | MHKSSPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQ KHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS with polyhistidine tag at the C-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Bio-activity : | Measure by its ability to enhance IFN gamma secretion in NK-92 cells. The ED50 for this effect is <6 ng/mL. The specific activity of recombinant mouse IL-21 is > 1.6 x 10^5 IU/mg. |
Purity : | >95% as determined by SDS-PAGE. Ni-NTA chromatography |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Notes : | Please use within one month after protein reconstitution. |
Gene Name | Il21 interleukin 21 [ Mus musculus (house mouse) ] |
Official Symbol | Il21 |
Synonyms | IL-21 |
Gene ID | 60505 |
mRNA Refseq | NM_001291041.1 |
Protein Refseq | NP_001277970.1 |
UniProt ID | A0A8C6GYE7 |
◆ Recombinant Proteins | ||
Il21-002H | Active Recombinant Human Il21, MIgG2a Fc-tagged | +Inquiry |
Il21-3512M | Recombinant Mouse Il21 Protein, Myc/DDK-tagged | +Inquiry |
IL21-047H | Recombinant Human interleukin 21 Protein, His&Flag tagged | +Inquiry |
IL21-2122H | Active Recombinant Human IL21 protein | +Inquiry |
IL21-2300H | Recombinant Human IL21 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL21-001RCL | Recombinant Rat IL21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il21 Products
Required fields are marked with *
My Review for All Il21 Products
Required fields are marked with *
0
Inquiry Basket