Active Recombinant Mouse Il1rn Protein, His-Tagged
Cat.No. : | Il1rn-01M |
Product Overview : | Recombinant mouse Il1rn Protein, His-tagged was expressed in E. coli cell |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | The interleukin-1 receptor antagonist (IL-1RA) is a protein that in humans is encoded by the IL1RN gene. IL-1RA was initially called the IL-1 inhibitor and was discovered separately in 1984 by two independent laboratories. IL-1RA is an agent that binds non-productively to the cell surface interleukin-1 receptor (IL-1R), the same receptor that binds interleukin 1 (IL-1), preventing IL-1 from sending a signal to that cell. |
Form : | Lyophilized powder |
AA Sequence : | MRPSGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNIKLEEKIDMVPIDLHSVFLGIHGGKLCLSCAKSGDDIKLQLEEVNITDLSKNK EEDKRFTFIRSEKGPTTSFESAACPGWFLCTTLEADRPVSLTNTPEEPLIVTKFYFQEDQ with polyhistidine tag at the C-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Bio-activity : | Measure by its ability to inhibit IL-1 alpha-dependent proliferation in D10.G4.1 cells. The ED50 for this effect is < 50 ng/mL. |
Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Notes : | Please use within one month after protein reconstitution. |
Gene Name | Il1rn interleukin 1 receptor antagonist [ Mus musculus (house mouse) ] |
Official Symbol | Il1rn |
Synonyms | IL-1ra; F630041P17Rik |
Gene ID | 16181 |
mRNA Refseq | NM_001039701.3 |
Protein Refseq | NP_001034790.1 |
UniProt ID | P25085 |
◆ Recombinant Proteins | ||
IL1RN-3298H | Recombinant Human IL1RN protein, His-tagged | +Inquiry |
IL1RN-104I | Active Recombinant Human IL1RN Protein (153 aa) | +Inquiry |
IL1RN-3350H | Recombinant Human IL1RN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Il1rn-56M | Active Recombinant Mouse Il1rn Protein (Arg27-Gln178), C-His tagged, Animal-free, Carrier-free | +Inquiry |
IL1RN-153H | Active Recombinant Human IL1RN Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1RN-2912HCL | Recombinant Human IL1RN cell lysate | +Inquiry |
IL1RN-1375RCL | Recombinant Rat IL1RN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il1rn Products
Required fields are marked with *
My Review for All Il1rn Products
Required fields are marked with *
0
Inquiry Basket