Active Recombinant Mouse Il1b Protein
Cat.No. : | Il1b-249I |
Product Overview : | Recombinant Mouse Il1b Protein without tag was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | CHO |
Description : | Interleukin-1 (IL-1) is a family of cytokines that play a central role in the regulation of immune and inflammatory responses to infections or sterile insults. IL-1α and IL-1β are the first two members discovered in this family, which are the products of distinct genes recognizing the same cell surface receptors. IL-1α and IL-1β are structurally related polypeptides that show approximately 25% homology at the amino acid level. Both proteins are produced by a wide variety of cells in response to stimuli such as those produced by inflammatory agents, infections, or microbial endotoxins. The proteins are synthesized as 31 kDa precursors that are subsequently cleaved into proteins with molecular weights of approximately 17.5 kDa. The specific protease responsible for the processing of IL-1β is interleukin 1β-converting enzyme (ICE)/caspase-1. Mature human and mouse IL-1β share approximately 75% amino acid sequence identity where human IL-1β has been found to be active on murine cell lines. Interleukin (IL)-1β, murine, produced in CHO cells, is a non-glycosylated polypeptide chain containing 152 amino acids and having a molecular mass of 17,400 Da. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 10 pg/mL, measured in a cell proliferation assay using D10S cells, corresponding to a specific activity of > 1 × 10^8 units/mg. |
Molecular Mass : | 17.4 kDa, observed by non-reducing SDS-PAGE. |
AA Sequence : | VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE and HPLC. |
Storage : | Lyophilized recombinant Murine Interleukin 1 beta (IL-1 beta) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmIL-1beta should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | Il1b interleukin 1 beta [ Mus musculus ] |
Official Symbol | Il1b |
Synonyms | IL1B; interleukin 1 beta; interleukin-1 beta; IL-1 beta; Il-1b; IL-1beta; |
Gene ID | 16176 |
mRNA Refseq | NM_008361 |
Protein Refseq | NP_032387 |
UniProt ID | P10749 |
◆ Recombinant Proteins | ||
Il1b-5314M | Recombinant Mouse Il1b protein, His-tagged | +Inquiry |
Il1b-509M | Recombinant Mouse Il1b protein, His-tagged | +Inquiry |
IL1B-3097H | Recombinant Human IL1B protein, GST-tagged | +Inquiry |
IL1B-5445S | Recombinant Sheep IL1B protein, His-tagged | +Inquiry |
IL1B-1030F | Active Recombinant Feline IL1B protein(Ala116-Ser267) | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1B-853HCL | Recombinant Human IL1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il1b Products
Required fields are marked with *
My Review for All Il1b Products
Required fields are marked with *
0
Inquiry Basket