Active Recombinant Mouse Il19 Protein (153 aa)
Cat.No. : | Il19-367I |
Product Overview : | Recombinant mouse Interleukin-19 (rmIL-19) produced in E. coli is a single non-glycosylated polypeptide chain containing of153 amino acids. A fully biologically active molecule, rmIL-19 has a molecular mass of 17.7 kDa analyzed by non-reducing SDS-PAGE and is obtained by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Protein Length : | 153 |
Description : | Interleukin-19 (IL-19) is a cytokine belonging to the interleukin family. Structurally, IL-19 is grouped into the IL-10 sub-family, which also includes IL-20, IL-22, IL-24, and IL-26. In contrast to IL-10, which exists as a homodimer, IL-19 is stable and active as a monomer in vivo. IL-19 functions through the receptor complex composed of IL-20 Receptor α and IL-20 Receptor β, which is also utilized by IL-20 and IL-24. IL-19 is produced by active monocytes and stimulated synergistically by IL-17 and IL-13. The functions of IL-19 are to promote the development and function of Th2 cells and to enhance the production of Th2 cytokines. IL-19 is implicated in aging, vascular disease, Type I diabetes, and rheumatoid arthritis. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 50 ng/mL, measured by a cell proliferation assay using MCF-7 cells, corresponding to a specific activity of > 2 × 10^4 units/mg. |
Molecular Mass : | 17.7 kDa, observed by non-reducing SDS-PAGE. |
AA Sequence : | MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% by SDS-PAGE analysis. |
Storage : | Lyophilized recombinant mouse Interleukin-19 (rmIL-19) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmIL-19 remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against 50mM acetic acid. |
Reconstitution : | Reconstituted in 50 mM acetic acid at 50 μg/mL. |
Gene Name | Il19 interleukin 19 [ Mus musculus ] |
Official Symbol | Il19 |
Synonyms | IL19; interleukin 19; interleukin-19; IL-19; |
Gene ID | 329244 |
mRNA Refseq | NM_001009940 |
Protein Refseq | NP_001009940 |
UniProt ID | Q8CJ70 |
◆ Recombinant Proteins | ||
IL19-4438H | Recombinant Human IL19 Protein, His (Fc)-Avi-tagged | +Inquiry |
IL19-156H | Recombinant Active Human IL19 Protein, His-tagged(C-ter) | +Inquiry |
IL19-138H | Active Recombinant Human IL19 Protein (Leu25-Ala177), C-His tagged, Animal-free, Carrier-free | +Inquiry |
IL19-1014H | Recombinant Human IL19 Protein, His-tagged | +Inquiry |
IL19-245H | Active Recombinant Human IL19 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL19-5242HCL | Recombinant Human IL19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il19 Products
Required fields are marked with *
My Review for All Il19 Products
Required fields are marked with *
0
Inquiry Basket