Active Recombinant Mouse Il17b Protein, His-Tagged

• Cat.No.: Il17b-01M
• Product Overview: Recombinant mouse Il17b Protein, His-tagged was expressed in E. coli cell

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Description: The interleukin (IL)-17 superfamily, a relatively new family of cytokines, consists of six ligands (from IL-17A to IL-17F), which bind to five receptor subtypes (from IL-17RA to IL-17RE) and induce downstream signaling. L17B Diseases associated with IL17B include spondyloarthropathy and neuronitis, and among its related super-pathways are Mucin expression in CF via IL-6, IL-17 signaling pathways, and STAT3 Pathway.
• Form: Lyophilized powder
• AA Sequence: MHPRNTKGKRKGQGRPSPLAPGPHQVPLDLVSRVKPYARMEEYERNLGEMVAQLRNSSEPAKKKCEVNLQLWLSNKRSLSPWGYSINHD
  PSRIPADLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPQPPRPGPCRQRVVMETIAVGCTCIF with polyhistidine tag at the C-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Bio-activity: Measure by its ability to induce IL-8 secretion in HepG2 cells. The ED50 for this effect is <1.5 ng/mL.
• Purity: >98% as determined by SDS-PAGE. Ni-NTA chromatography
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Notes: Please use within one month after protein reconstitution.

Gene Information

• Gene Name: Il17b interleukin 17b [ Mus musculus (house mouse) ]
• Official Symbol: Il17b
• Synonyms: Zcyto7; 1110006O16Rik; 1700006N07Rik
• Gene ID: 56069
• mRNA Refseq: NM_019508.1
• Protein Refseq: NP_062381.1
• UniProt ID: Q9CTI4