Recombinant Active Human IL17B Protein, His-tagged(C-ter)

• Cat.No.: IL17B-150H
• Product Overview: Recombinant Active Human IL17B Protein with His tag (C-ter) was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: The protein encoded by this gene is a T cell-derived cytokine that shares sequence similarity with IL17. This cytokine was reported to stimulate the release of TNF alpha (TNF) and IL1 beta (IL1B) from a monocytic cell line. Immunohistochemical analysis of several nerve tissues indicated that this cytokine is primarily localized to neuronal cell bodies. [provided by RefSeq, Jul 2008]
• Form: Powder
• Bio-activity: Determined by its ability to induce IL-8 secretion in human PBMCs. The ED50 for this effect is < 49 ng/mL.
• AA Sequence: MQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF
• Endotoxin: Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
• Purity: > 98% (by SDS-PAGE)
• Applications: SDS-PAGE
• Notes: For laboratory research only, not for drug, diagnostic or other use.
• Storage: Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
• Storage Buffer: PBS (pH 8.0)
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.

Gene Information

• Gene Name: IL17B interleukin 17B [ Homo sapiens ]
• Official Symbol: IL17B
• Synonyms: IL17B; interleukin 17B; interleukin-17B; IL 17B; IL 20; MGC138900; MGC138901; neuronal interleukin 17 related factor; NIRF; ZCYTO7; interleukin 20; interleukin-20; cytokine Zcyto7; interleukin-17 beta; cytokine-like protein ZCYTO7; neuronal interleukin-17 related factor; neuronal interleukin-17-related factor; IL-20; IL-17B
• Gene ID: 27190
• mRNA Refseq: NM_014443
• Protein Refseq: NP_055258
• MIM: 604627
• UniProt ID: Q9UHF5