Active Recombinant Human IL17A Protein

• Cat.No.: IL17A-102H
• Product Overview: Recombinant Human Interleukin-17A is produced by our E.coli expression system and the target gene encoding Ile20-Ala155 is expressed.

Specification

• Species: Human
• Source: E.coli
• Protein Length: Ile20-Ala155
• Description: Interleukin-17 is a potent pro-inflammatory cytokine produced by activated memory T cells. There are at least six members of the IL-17 family in humans and in mice. As IL-17 shares properties with IL-1 and TNF-alpha, it may induce joint inflammation and bone and cartilage destruction. This cytokine is found in synovial fluids of patients with rheumatoid arthritis, and produced by rheumatoid arthritis synovium. It increases IL-6 production, induces collagen degradation and decreases collagen synthesis by synovium and cartilage and proteoglycan synthesis in cartilage. IL-17 is also able to increase bone destruction and reduce its formation. Blocking of interleukin-17 with specific inhibitors provides a protective inhibition of cartilage and bone degradation.
• Form: Lyophilized from a 0.2 um filtered solution of 20mM PB, pH 7.4.
• Bio-activity: ED50 is approximately 2 ng/ml. Specific Activity of 5 x 10^5 IU/mg. Measured by the dose-dependent induction of IL-6 in primary human foreskin fibroblasts.
• AA Sequence: MIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERY PSVIWEAKCRHLGCIN ADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
• Endotoxin: Less than 0.1 ng/ug (1 EU/ug).
• Purity: >95%
• Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
  Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.
  Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
• Quality Statement: Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Shipping: The product is shipped at ambient temperature.
  Upon receipt, store it immediately at the temperature listed below.

Gene Information

• Gene Name: IL17A interleukin 17A [ Homo sapiens (human) ]
• Official Symbol: IL17A
• Synonyms: Interleukin-17A; IL-17; IL-17A; Cytotoxic T-Lymphocyte-Associated Antigen 8; CTLA-8; IL17A
• Gene ID: 3605
• mRNA Refseq: NM_002190.3
• Protein Refseq: NP_002181.1
• MIM: 603149
• UniProt ID: Q16552