Active Recombinant Mouse Il17a Protein (133 aa)

• Cat.No.: Il17a-253I
• Product Overview: Recombinant murine IL-17A is a 15-20kDa glycosylated cytokine of 133 amino acid polypeptide chain that plays an important role in antimicrobial and chronic inflammation. IL-17 exhibits multiple biological activities on a variety of cells including the induction of IL-6 and IL-8 production in fibroblasts, the enhancement of surface expression of ICAM-1 in fibroblasts, activation of NF-κB and costimulation of T cell proliferation.

Specification

• Species: Mouse
• Source: CHO
• Protein Length: 133
• Description: Interleukin-17A, (also known as CTLA-8) is a T cell-expressed pleiotropic cytokine that exhibits a high degree of homology to a protein encoded by the ORF13 gene of herpesvirus Saimiri. cDNA clones encoding IL-17 have been isolated from activated rat, mouse and human T cells. IL-17 represents a family of structurally-related cytokines that share a highly conserved C-terminal region but differ from one another in their N-terminal regions and in their distinct biological roles. The six known members of this family, IL-17A through IL-17F, are secreted as homodimers.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: Measured by its ability to induce IL-1a, IL-4 and IL-6 production by primary mouse splenocytes.
• Molecular Mass: 15-22 kDa, observed by reducing SDS-PAGE.
• AA Sequence: AAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE.
• Storage: Lyophilized recombinant Murine Interleukin-17A (IL-17A) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, recombinant murine IL-17A should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: Il17a interleukin 17A [ Mus musculus ]
• Official Symbol: Il17a
• Synonyms: IL17A; interleukin 17A; interleukin-17A; cytotoxic T-lymphocyte-associated antigen 8; Il17; Ctla8; IL-17; Ctla-8; IL-17A
• Gene ID: 16171
• mRNA Refseq: NM_010552
• Protein Refseq: NP_034682
• UniProt ID: Q62386